CAZyme Information: MGYG000004133_01117

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; HGM11514; HGM11514
• CAZyme ID: MGYG000004133_01117
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
669		77175.43	4.7435

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004133	2160156	MAG	United Kingdom	Europe

• Gene Location: Start: 8784; End: 10793 Strand: -

Full Sequence      

MEHKFKGKWITDDEFFDLSPRNVFHKQLEVVDLPCDEHRNRHILFRRSFQLSEIKDSVMY
ISADDYYKLYINGCFVAQGPTMSYHFQYNYNAIDVTDFLKSGENTIAVHTLYQGLINRVW
QSGDNRHGLILDLVCDGETVVSSDESFKTAVHTAYSEIGTVGYDTQFLEEYNSGAREVGF
EKPGFDDSYWQNAKIKENDDHALVLQKSSMLEFESIKPTEAYVTKNGMIYDFGAMYVGYL
ELTVTGRAGDKLIVRCAQELNDDGSLRFDLRANCRYEETFIIQDGTSVLDWFDYKAFRYA
ELVIPEGCVVKSVSLTARHYPFTLAAKLKPEFADNKDLVKIWELCVRSQKYGVQEIIQDC
MEREKGFYLGDGCYTALANMILTGDDSMVRRLIDDAFSTSFITDTLVTCMNCSFMQEIAE
FPLILVDTVLWHYRLTGDTDYLAINYEKAVMLLEAFRKKHEDGYLLRNLDKWCVVEWPDN
FRHGYDVALVQGEVCKEAHISINAYYIEAIISVNKMAGILKNEKYRDEKPLLDTFKRVFY
DENKKLFKDSEISSHISLVGNSFVYGFDLCDDEEFKESFISMFEKNGIDSLSLFCTFPCL
KGFCRNGRYDLVRESLLNEGAWKRTLREGGTATFEGWGKETKWNTSLFHLTMSYAAVFMA
DIDTGKLFE

Enzyme Prediction     

No EC number prediction in MGYG000004133_01117.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	225	659	2.1e-56	0.8531746031746031
CBM67	38	195	1.6e-37	0.8806818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08531	Bac_rhamnosid_N	3.29e-19	53	220	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17389	Bac_rhamnosid6H	2.01e-09	334	657	9	332	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	2.13e-09	229	319	9	100	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
PRK10340	ebgA	5.05e-04	44	124	112	182	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43798.1	1.73e-213	2	667	73	740
AEN95938.1	1.03e-128	8	649	28	673
QQQ99835.1	1.19e-128	5	649	4	710
ANU45395.1	1.19e-128	5	649	4	710
AFH60330.1	8.69e-126	1	649	1	656

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.23e-22	2	554	142	680	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	1.55e-10	40	302	129	403	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	1.13e-09	46	562	306	811	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
2OKX_A	2.49e-09	39	194	20	177	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	6.15e-09	46	562	306	811	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004133_01117.