CAZyme Information: MGYG000004135_00612

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; Agathobaculum
• CAZyme ID: MGYG000004135_00612
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
184		21039.59	4.4292

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004135	1528355	MAG	United Kingdom	Europe

• Gene Location: Start: 1895; End: 2449 Strand: -

Full Sequence      

MLYTLSGNESREWVDSEQIPQYLKDAAVAIEDERFYSHNGVDWKRTLGAVKNWLFGGTQY
GGSTITQQLIKNATDEDDYSVKRKINEIFRALALEDVVNDKDRILTMYLNTIYLGYRCYG
VQTAADRYFGKDVSELTLAECAVLAGLTNNPSVYDVYNHPEKVKERQELILAQMLEQGMI
DQDT

Enzyme Prediction     

No EC number prediction in MGYG000004135_00612.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	7	174	1.7e-64	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.88e-83	7	175	9	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	5.26e-73	6	183	71	249	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	1.35e-69	11	184	2	175	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	1.85e-58	2	183	58	239	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	4.29e-43	17	182	72	237	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI59848.1	3.71e-62	7	182	107	283
QNL43378.1	1.05e-57	2	183	88	272
BCK80539.1	1.76e-57	1	184	90	275
BAK99350.1	5.55e-57	2	184	92	288
QEY34222.1	5.88e-57	4	180	91	266

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	6.33e-40	2	180	11	189	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	8.96e-40	2	180	11	189	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	3.72e-34	13	182	59	234	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	4.11e-34	13	182	23	198	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	4.22e-34	13	182	24	199	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O87626	5.22e-42	7	180	64	237	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
O86088	1.08e-39	7	180	64	237	Penicillin-binding protein 1A OS=Neisseria cinerea OX=483 GN=mrcA PE=3 SV=1
Q8XJ01	2.56e-39	9	183	89	272	Penicillin-binding protein 1A OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=pbpA PE=3 SV=1
Q0TNZ8	3.95e-39	9	183	89	272	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
Q5FAC7	7.04e-39	7	180	64	237	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mrcA PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997593	0.002319	0.000074	0.000007	0.000004	0.000024

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004135_00612.