CAZyme Information: MGYG000004136_00505

Basic Information

• Species: Eisenbergiella sp900555195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900555195
• CAZyme ID: MGYG000004136_00505
• CAZy Family: GH51
• CAZyme Description: Intracellular exo-alpha-(1->5)-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
497	MGYG000004136_8|CGC1	56836.16	5.5705

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004136	3901051	MAG	United Kingdom	Europe

• Gene Location: Start: 5546; End: 7039 Strand: -

Full Sequence      

MKVQINPRRELGKRDPMIYGQFIEHFHRQIYGGIYDPGNALSDEDGFRTDIIEAMKKIKV
PVLRWPGGCFVSSYHWKDAVGENRKPLFDKAWRVEDPNTFGTDEYIRLCRKIGCAPYICT
NAGTGTPEEMSDWVEYCNLENEGRYAKWRIHNGHPEPYKVKYWSIGNENYGHWEIGAKSS
DEWGRLVRESAKMIKHVSPDAELSAAALADIDWNINLLKNCGPYLDWISVHEYWDMMPEE
HKPATYEECMAFTDHIDHAVDEVRGMLKALKLDGSIRIAFDEWNLRSWHHPNVHTIKQGL
EKKDYVLPRDKNDDNSTYTMADAVFSACFLNAMNRNCDIVGMANFAPVLNTRGCIYSYQD
GIVLRSTYHVFDLYVNHLGDTVVDLWKEEASPVMRVRHKAGGTREVDTLDLLATKWSDRE
GIAVAAVNKDPVNSQELVIGLDGSVKDPVIYRLDGTSENAYNDVDRTEVQIEKEALNACE
GVLKVTLHPHSVNIIQF

Enzyme Prediction     

No EC number prediction in MGYG000004136_00505.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	2	496	4.9e-112	0.7222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3534	AbfA	3.19e-120	2	495	5	496	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].
pfam06964	Alpha-L-AF_C	2.44e-32	281	491	1	192	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
smart00813	Alpha-L-AF_C	1.32e-26	281	491	1	189	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB56385.1	2.71e-265	1	496	1	495
QMW80840.1	2.71e-265	1	496	1	495
QBE94709.1	2.71e-265	1	496	1	495
QJU16949.1	4.16e-262	1	496	1	504
AEF80325.1	2.85e-229	3	497	4	495

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2C_A	3.58e-100	2	496	4	480	Structureof the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_B Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_C Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_D Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_E Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_F Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_G Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_H Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_I Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_J Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_K Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_L Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1]
4ATW_A	9.48e-100	2	496	4	480	Thecrystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_B The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_C The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_D The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_E The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_F The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8]
3UG3_A	3.56e-99	3	496	25	500	Crystalstructure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_B Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_C Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_D Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_E Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_F Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG4_A Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_B Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_C Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_D Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_E Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_F Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG5_A Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_B Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_C Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_D Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_E Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_F Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima]
5O7Z_A	1.74e-70	10	496	12	499	ChainA, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O7Z_B Chain B, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O7Z_C Chain C, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O7Z_D Chain D, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O7Z_E Chain E, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O7Z_F Chain F, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O80_A Chain A, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O80_B Chain B, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O80_C Chain C, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O80_D Chain D, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O80_E Chain E, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O80_F Chain F, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila]
2C7F_A	2.33e-70	10	496	23	510	ChainA, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_B Chain B, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_C Chain C, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_D Chain D, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_E Chain E, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_F Chain F, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C8N_A Chain A, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_B Chain B, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_C Chain C, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_D Chain D, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_E Chain E, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_F Chain F, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2QQ94	3.35e-77	3	497	15	502	Probable alpha-L-arabinofuranosidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=abfC PE=3 SV=1
A1CQC3	1.07e-74	3	497	15	502	Probable alpha-L-arabinofuranosidase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=abfC PE=3 SV=2
Q5BDV3	2.05e-74	3	469	15	477	Alpha-L-arabinofuranosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=abfC PE=2 SV=1
B8NIX4	2.88e-74	3	497	15	502	Probable alpha-L-arabinofuranosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=abfC PE=3 SV=1
Q0D1I6	1.57e-73	3	497	15	502	Probable alpha-L-arabinofuranosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=abfC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004136_00505.