CAZyme Information: MGYG000004136_01836

Basic Information

• Species: Eisenbergiella sp900555195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900555195
• CAZyme ID: MGYG000004136_01836
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
696	MGYG000004136_43|CGC1	80732.43	5.5041

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004136	3901051	MAG	United Kingdom	Europe

• Gene Location: Start: 20603; End: 22693 Strand: -

Full Sequence      

MNIKKLLQAPLRRRQTRRYEARIEEQTVRYHDWIVRKEQKEQSGLSLKGQELKLRCIPFE
ECGVSFPAARQMEDAHGLRPEDGAQADGEILVFYGGGVRPEDGALARIADYFARHPEIIL
AYADEDERLEENGGRRTNPWLKPDWSPDTLMSYFYFGNLFAVRAKAAEAVEWLQEEDYRK
NLYDFCLKLTDKASPGPEENEAAQAGKRAVGHIDSVLLHNGMPIEPFGMEEEYDGIKRQA
YIRRGWPEKPSGMVSIIIPSKDNPRVLSTCIHSILEGSSYLDFEIIVIDNGSSDKNRKRI
ERMLSMMTEDCRFRYVYEPMEFNFSRMCNRGAALAKGDYILLLNDDIEVPQDDWLERMVE
KAALPHVGAVGVKLLYPESHTIQHAGITNIRLGPAHKLQFRDDRNDYYFLRNRLAFDVLG
VTGACLMVRRSVYEKSGGLKEELRVAFNDVEFCYRLHEMGYQNVVRNDVALYHHESLSRG
LDDSVEKLKRLHQELNLLYTLHPTYYAADPYYHRYLVRDVLDQEFYAGNRYEYEDRVDTV
VPQAMRDGLRPEWKNEVLRMGIEFAGDMQKWETGRPGGGDYFIQGWCYALQVDNSQYRFN
LLLKEAKRDDGPMREEAAENASGLSAVWRLPVNRQYRPDIQENLGHMQMVALTGVCLRFD
RNALPEGEYLIGFLWEDCCSRQKLYQWTAETMRIES

Enzyme Prediction     

No EC number prediction in MGYG000004136_01836.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	255	435	8.6e-27	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	3.44e-36	256	475	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	6.92e-27	253	506	4	254	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	6.39e-24	255	433	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	4.52e-21	256	461	1	152	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06433	GT_2_WfgS_like	9.18e-20	255	456	1	176	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02107.1	4.41e-117	104	695	67	668
ADL33298.1	1.04e-112	108	695	107	703
AOZ95571.1	3.25e-110	108	695	107	702
CBK92935.1	1.47e-99	86	522	139	582
AVK48684.1	8.52e-99	86	695	780	1362

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.66e-55	104	512	465	884	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	6.57e-44	84	547	398	858	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P04341	6.88e-06	249	370	46	165	N-acetylglucosaminyltransferase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=nodC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004136_01836.