CAZyme Information: MGYG000004136_03062

Basic Information

• Species: Eisenbergiella sp900555195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900555195
• CAZyme ID: MGYG000004136_03062
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1281		136972.7	5.1485

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004136	3901051	MAG	United Kingdom	Europe

• Gene Location: Start: 6502; End: 10347 Strand: +

Full Sequence      

MTERRDERGDREGRRSLQQELSKEPDELLENKEPISRKIEKVTEELLSEWEISEDDFEET
GDLTETSRRLAEEVIGRREGEMAGKNVRSIREEGAVREKSGRPQRADSRSTAPASGRDIE
RREAAAREGRAEYARKPERRSEGAKGSAPERRAAHRSEERKHSAQEQRPVRRNGQDKRSA
GERSVSSERGLSESRTTRRSDGSAAGTEYGASSRREGSRRAERLPENRERRPGRTNRGRS
ASGRRKGNVFLRFWDSLQTMDKVVGLTGIGVCLVAAITFSIVLNARGVNRQVETFAQVGE
NLSQIAVADESTFLAVADGHLARQQAASAQETEEYNEKEDDSEIQVGLNMTSVEKDLKIK
FVNRKTGKLIPYVAFEAEIKGPDETYQKTDDDKDGIIYLTGITGGTYTVRVTGPEGLEGY
ILPEDAQSVEVKNQIAYEKIDVSDEIKSESEVNAAKEDTEIKTEVESVLQDTVEWVESTK
TPIGGDGNAYIEVKKADVPDPAASASLDFGLFAGVRIRPAQMAGLAIWSQPAEAGMMRLS
TVAEPTSTVPEPEEPSSTEPTQTVPEEPKDVAVTGVEISPKELSGTVGGSGSLSASVKPD
DATNKGVKWSSSDTGVATVDGSGTVSFVGAGSATITVTTDEGSHTASASVKVVEEEKKVE
KVEVTGDGSVSVGGSITLSATISPSGASYDGVSWSSSDSSIATVDGGKVTGVKAGSVTVT
ATAGGVSGSKTVEVKNAEVAVGSIKINGSTSAKKGETVQLSITAEPAGADASVKWESSNP
SVASVDGNGKVTAKETGSTTIKATSLKDGSKTASITFTVTSNETNSVTLSDMKITAGETK
GADLKTTGSVSSKSFSIANTKYATVDGSGNIRAIRSGETELTVTVKFSNGETVTKKAKLT
VAAAEVKKITLDKTSVTLKVGESLKLNPTIETTGYTGCLWYTSDASIVTVTEHGNGTIKA
VKAGKVTITACSSEDTSKKATCEVTVTGKDLKDDTTTKLKDKDGKQLYVKNADGKYVEAV
VADYYKYDVFYRLNENVEYKYTGWQTIDGKRYYFDKDGNKVTGEQVIQGVKYNFGSDGAL
SGGSGVLGIDVSKHNGNINWTEVKNSGVSFVIIRCGYRGSSTGAMIEDPKFKANIQGATA
AGLKVGVYFFSQAVNRVEAVEEASMTLELIKGYKISYPVFLDVEASGGRADGIDSGTRTE
IVNAYCETIRNSGYTAGVYANKTWLNSKMNTGSFGSNKIWLAQYAAAPTYNGRYEMWQYS
STGKIGGISGNVDLNLSYLGY

Enzyme Prediction     

No EC number prediction in MGYG000004136_03062.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	1089	1268	2.8e-47	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	2.01e-90	1088	1278	3	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	5.36e-43	1088	1276	2	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	7.71e-35	1089	1268	1	180	Glycosyl hydrolases family 25.
cd06525	GH25_Lyc-like	1.85e-34	1088	1275	2	182	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06522	GH25_AtlA-like	8.47e-30	1089	1278	4	192	AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL33290.1	9.51e-171	251	1278	249	1225
QNM02116.1	3.41e-151	239	1281	196	1102
AOZ95561.1	2.28e-143	220	1278	227	1213
QNM02113.1	2.68e-68	1083	1278	234	431
CBK74089.1	5.90e-68	999	1277	244	516

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	8.61e-25	1008	1278	209	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	2.06e-24	1008	1278	209	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
1JFX_A	1.35e-17	1084	1275	3	200	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4KRU_A	1.03e-14	1088	1275	22	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	5.93e-14	1088	1275	22	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25310	3.17e-16	1084	1275	80	277	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	9.06e-14	1088	1275	11	194	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P34020	9.91e-14	1088	1275	3	178	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
P33747	5.03e-09	571	721	35	185	Uncharacterized protein CA_P0160 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=CA_P0160 PE=3 SV=2
P85991	3.58e-07	567	720	84	241	Ig-like virion protein OS=Serratia phage KSP90 OX=552528 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
263	285