CAZyme Information: MGYG000004138_01631

Basic Information

• Species: QAMH01 sp900544245
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; QAMH01; QAMH01; QAMH01 sp900544245
• CAZyme ID: MGYG000004138_01631
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803		90366.24	4.8841

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004138	1946641	MAG	United Kingdom	Europe

• Gene Location: Start: 32871; End: 35282 Strand: +

Full Sequence      

MSTLVALRRLRWIAKGLRDGGFQDFRTIGIAVINVFQAGNGMIRLEGWVYSFRLLTNRPI
LEVLQDDKAIFTKTINTRRSPAAESYFGNKDLGDAGIYAFLQYESNVDLSARLRFETPKG
DYFLNLGTIRKNTSKAIHPRVFDPWESNQFGEIDLGYMQLGSLRPYLQNNPSTTEDIVDI
IIPIYNGLELLSPLFESVKQTSLPYRLIIINDASPDSRVDDYLQSVADNADNVILIENDR
NLGFVRSVNRGLSMSSNDVVILNTDTELPDRWLERLIRPIRIDETVASATPMTNSGTICS
FPNFLENNRLFDGLSLKAIDEQFGKMIPLYTEVPTGVGFCMAMSRSALAKIGALDEETFG
KGYGEENDWCQRAIKAGFKNVLVENLFVYHKHGGSFESDEKRALCEAHEKKLLEKHPTYL
EEVACFCQADPLSQFRSYVQSALRCSQLPPLLLVFNHLLGGGANDYLEKEKPKILEQGRA
IATLAFEPVEYMYHLTVEYGELSFQCLSTSLASLLSLFDDVDEVWINELVTFGQIQGNME
TIRDFIRVRKPLCKILIHDYFPICPSINLLDCEGRFCGIPSNLMKCQECYKKKGFDREYG
ATILDYRSKWKALFGEEADVVCFSVSSEELLTRAFPQIARVIVSPHAVRPLPKVKTNGYD
HDEIRIGIIGRMCEHKGASIVKSIAEHSRAAGISVVLFGDFEDGQKPDGIKVIGEYQRDE
LSNLVQSEEIDVIFFPSIWPETFSFTCSEAISMGLPVASFDIGAPAERIRAYDLGKVMPL
DLDIEEIVDELIRHANKSGVPNS

Enzyme Prediction     

No EC number prediction in MGYG000004138_01631.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	179	351	2.5e-20	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	2.99e-32	180	392	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.40e-31	180	395	7	224	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd03823	GT4_ExpE7-like	6.04e-25	610	793	136	323	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
pfam00535	Glycos_transf_2	3.38e-21	179	348	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	3.43e-17	180	323	1	143	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCU01345.1	9.13e-172	33	792	756	1516
BBK78212.1	2.31e-168	170	797	159	788
QMW89726.1	2.31e-168	170	797	159	788
QNM10216.1	7.41e-168	25	792	735	1502
AXS39871.1	1.03e-139	178	780	220	834

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004138_01631.