CAZyme Information: MGYG000004142_00449

Basic Information

• Species: Marseille-P3106 sp900169975
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Marseille-P3106; Marseille-P3106 sp900169975
• CAZyme ID: MGYG000004142_00449
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
652	MGYG000004142_2|CGC1	73833.69	8.0452

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004142	2105294	MAG	United Kingdom	Europe

• Gene Location: Start: 139718; End: 141676 Strand: +

Full Sequence      

MQYITPSILFALVTLFCVGLFLLRYVRTAWNGPLGADWVRGRTGSGRLTFAGTCHPMEKQ
DRLPVLLITLVYAATAFFLLGDTTAPQSVYEFAGGEPVTIAVYGDAVYTTGIRYYSGLGT
GAYNVEISADGENWLTLWQRKNDPEDTEKVTGWYWAQAEDYDPSYALTQKYNQLYKWIDI
TVENPQNVRFLRITGKAEKPHLQLSKFCLLGQDGQPVPFHWALADGSKAASEVRDLFSVD
ATVPAKSTWYNSTYFDEIYHARTAQEHIQGVYPYEVTHPPLGKLILGIGIRLFGMTPFGW
RFMGTLFGVGMLPILYVFLKNLFGKTPAAACGTILFAVDFMHLTQTRIATIDTYGVFFIL
CMYFFLYRYLTLPAGTSFRQGALPLFLSGLMWGLGAASKWTVIYAAVGLAVLYFMGFYQK
LRDWPEEQRGERAVWCVKTLAFSVLCFVVIPLCIYCAAYLPYAMAKGDTSLKGLLSTVWE
NQKYMLHYHEGVNQSHPYSSRWYQWIVDGRPILYYMDNTVPGFTTRFAAFSNPAVCWAGL
GAVILCAVQAFRRRSAKAAFVVVGYLSQLVPWMFIGRTTFEYHYFPSILFLILALSFLFS
GLMEADEGWRRPVYGLTCLSTGLYALFYPVLIGLTIPTWYEPLVKWIESWPF

Enzyme Prediction     

No EC number prediction in MGYG000004142_00449.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	251	462	1.8e-52	0.9147982062780269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	1.88e-18	246	455	41	260	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	6.11e-18	479	633	4	172	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
pfam02366	PMT	9.99e-15	249	464	17	242	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1928	PMT1	6.52e-14	480	652	503	695	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam13231	PMT_2	2.42e-12	278	415	2	129	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU42918.1	2.30e-278	8	652	13	653
QQR07704.1	2.30e-278	8	652	13	653
QIA32159.1	2.30e-277	8	652	9	649
QBB67038.1	1.79e-260	2	652	14	752
ALP95330.1	3.59e-260	2	652	14	752

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	9.39e-27	276	650	100	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	9.39e-27	276	650	100	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	3.04e-22	276	650	94	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	9.84e-22	276	650	97	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
Q29IL2	7.34e-07	552	652	642	749	Protein O-mannosyl-transferase 2 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=tw PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	26
63	85
297	319
354	376
396	418
439	461
523	545
558	575
580	602
614	636