CAZyme Information: MGYG000004151_00391

Basic Information

• Species: Pseudomonas citronellolis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas; Pseudomonas citronellolis
• CAZyme ID: MGYG000004151_00391
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
205	MGYG000004151_2|CGC2	22217.45	8.7103

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004151	7110046	MAG	United Kingdom	Europe

• Gene Location: Start: 132799; End: 133416 Strand: +

Full Sequence      

MAGRKTFLSAAVLALIAAGASAPAIMDQFIQEKEGESLTAYQDGARVWTICNGRTAGVTR
STIMTKAECDAWRQTEIGRRLAFVHSVIKPEMSEPAWAGIASWCLNVGDTGCAGSNAVSL
INSGNQPAGCRAMLSWRFITRSMTIAEASAFAARASNQADVKKRIRLAQSLGKQRVDVKV
DCSDEQPWCKGLWQRRQAEAEMCTL

Enzyme Prediction     

EC	3.2.1.17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	27	199	2.2e-23	0.9562043795620438

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16900	endolysin_R21-like	1.45e-26	10	138	1	121	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	8.73e-21	16	137	1	125	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd00737	lyz_endolysin_autolysin	1.74e-18	28	137	3	114	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd16901	lyz_P1	4.04e-11	28	203	8	139	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEK42099.1	7.51e-88	1	205	1	170
QBN04509.1	7.51e-88	1	205	1	170
QBN00363.1	7.51e-88	1	205	1	170
QQQ24438.1	3.10e-31	1	136	1	141
QLT88694.1	3.10e-31	1	136	1	141

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P68920	2.27e-28	8	136	9	142	SAR-endolysin OS=Escherichia phage 933W OX=10730 GN=R PE=3 SV=1
P68921	2.27e-28	8	136	9	142	SAR-endolysin OS=Enterobacteria phage VT2-Sa OX=97081 GN=R PE=3 SV=1
O64362	6.53e-28	8	136	7	140	SAR-endolysin OS=Escherichia phage N15 OX=40631 GN=54 PE=3 SV=1
P76159	3.90e-26	8	136	9	142	Probable prophage lysozyme OS=Escherichia coli (strain K12) OX=83333 GN=rrrQ PE=3 SV=1
Q9ZXB7	1.53e-25	8	136	9	142	SAR-endolysin OS=Enterobacteria phage H19B OX=69932 GN=R PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.249117	0.178943	0.001649	0.564741	0.005213	0.000322

TMHMM  Annotations     

start	end
7	26