CAZyme Information: MGYG000004153_00040

Basic Information

• Species: UBA7102 sp900760085
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UBA1750; UBA7102; UBA7102 sp900760085
• CAZyme ID: MGYG000004153_00040
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233	MGYG000004153_1|CGC2	26436.32	5.7672

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004153	2844425	MAG	United Kingdom	Europe

• Gene Location: Start: 41770; End: 42471 Strand: +

Full Sequence      

MKRLKKLIKRLFLLTVVVIVIAGCVLAGSGYKMYRDALNHQGLESKVAEIQSNPSYTTLS
EMPELYLDAVVAVEDHRFEQHLGIDLIAIGRAAWNNLTSWSLREGGSTITQQLAKNMYFT
QEKSFIRKIAEMFMAFRLESSYTKDEILELYVNSIYFGDGYYCVRDASQGYFGKDPIDMT
DYESTLLAGIPNAPSVYSLTANPDLAEQRQQYVIQQMVKYGYISEGEGKKLLQ

Enzyme Prediction     

No EC number prediction in MGYG000004153_00040.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	48	218	7.9e-62	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	3.93e-83	53	218	12	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	8.72e-78	56	230	4	178	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	6.38e-71	1	233	4	256	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	3.83e-68	4	230	1	243	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	4.49e-47	58	227	70	239	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO38940.1	7.26e-124	1	233	1	233
QRP41835.1	5.14e-87	27	225	26	224
ASN93505.1	5.14e-87	27	225	26	224
QJU22158.1	4.18e-86	27	225	26	224
QIX92252.1	1.38e-84	27	225	26	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.11e-42	56	224	22	190	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	2.21e-42	56	224	22	190	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	9.05e-39	43	225	30	210	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3HZS_A	3.06e-35	40	225	7	198	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	3.15e-35	40	225	8	199	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q07259	3.27e-46	12	227	8	219	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
O87579	4.25e-42	56	219	70	233	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
P38050	5.63e-42	53	227	66	240	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P0A0Z5	2.04e-41	56	219	70	233	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1
Q5FAC7	2.04e-41	56	219	70	233	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mrcA PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.127698	0.002624	0.869448	0.000014	0.000013	0.000210

TMHMM  Annotations     

start	end
7	29