CAZyme Information: MGYG000004153_01538

Basic Information

• Species: UBA7102 sp900760085
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UBA1750; UBA7102; UBA7102 sp900760085
• CAZyme ID: MGYG000004153_01538
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
657	MGYG000004153_19|CGC1	73269.14	4.9279

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004153	2844425	MAG	United Kingdom	Europe

• Gene Location: Start: 7406; End: 9379 Strand: +

Full Sequence      

MAYWIWFPHDFSIDLRGRVEMRRQEHGMTCPSIWRMDAPSRAVAFRRAYTLDAPGRARLF
SQGEAYVCIDGASIPDRAQEIALPAGSHVLTVSVMSLTSLPALYLEGDVETDGSFFACEN
NVDFVPCGWSPAFCAPDKRPMDYCLPTRPLSPAGRTEEGLIDFGREVFGFLHLTSAAPGA
YTVYYGESAAEALAGKQGETWDAGAFLRAGEEVRLPSRAMRFVRVDGPADLSAAWLEEEY
NGLPWRAAFSCEDERLNAIYDVSARTMELCTREFFLDGIKRDRWVWAGDALQSVLINHYS
YLDRATTRRTLAALRGRDPFNQHINTILDYTFYWMIAVWEDYFYTGDPSFLAGMYEKMVS
AMDYTLRFTSADGFVVGQKRDWVFVDWADMRKEGELCVEQVLLWKALRVLADSAAVLGKA
ADAAAYAARAGALRDRILAVFWSEEQGTLLHQRVDGKVQGHTRYAPLFALLYGLLPEDKA
RLATENTLLSDAAPAITTPYMRFYEMDALLRAGRTREVLEGVRAYWGGMLDLGATSIWEQ
FDPSETGDEHYAMYGRPFGRSLCHCWGAGPVYLCGRHILGVAPTAPGYAQYEVCPNPGDL
RRVEGTVPTPDGSLSVRIEDGRVRVSSTCRGEGVLLWQGQRAPLPPCAGPEPVVVEL

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	160	625	6.9e-101	0.9523809523809523

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.78e-25	249	578	6	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.41e-04	580	626	1	50	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	0.001	317	491	328	513	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam04685	DUF608	0.008	338	368	108	138	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGA77946.1	6.89e-177	2	643	33	698
QTH42706.1	1.57e-176	2	643	4	654
QDH81526.1	1.94e-175	2	643	29	694
ABQ07113.1	1.43e-172	2	643	32	696
AWK06456.1	1.14e-171	2	643	32	696

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	8.73e-151	4	643	20	700	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	1.39e-41	228	612	518	910	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	1.50e-28	160	579	96	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004153_01538.