CAZyme Information: MGYG000004153_02020

Basic Information

• Species: UBA7102 sp900760085
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UBA1750; UBA7102; UBA7102 sp900760085
• CAZyme ID: MGYG000004153_02020
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627	MGYG000004153_30|CGC1	70521.27	6.5512

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004153	2844425	MAG	United Kingdom	Europe

• Gene Location: Start: 2740; End: 4623 Strand: -

Full Sequence      

MIDRAIFHRAPLAPDAFAPLPTGAIKPLGYLLAAERAQANGLGGQITRVWDGLRDSAWMG
GKGENWERGPYYLDGLIPLAWQLEDEELQNLARRFVDWILASQDEEGFFGPKDNPDWWPR
MVVLKALQQYFTITGDKKILVFLTKYFAYMAHKLDEQPLGLWAIARAGDCVDAILWLYDI
TGKAGLLKLCDKVLGQAMDWTRHFHTFPDEQDQKRAHPWSMLEPRLKATDDPWSEAWQIH
QRTHVVNLAMALKTPQVEHALHGGTKQADAFRAGWEKLTRFHGVANGMFTGDEHLSGANP
SQGTETCAVVETLYSLERVLALTGEARVGDLWERIAYNALPAALSPDGWAHQYDQQVNQI
RIDRYPRAWYNNKPDANVFGLEPNYGCCTANLHQGYPKFTAHLWMAVRGGGLAAQSYAPC
EVLWRAGQTRIRLTVQGDYPTQERVRIRLKMEGEARFPIQLRIPGWAEGAHAEVAGERLE
GTPGQYLRLERVWCDGDEIELTLPMQVRTEKWHHQTLAVYRGPVLFALPVPAKWEYKGEM
PLCDRWAEPQGPWNYALVPEEGFAVEGGGARIACSAVRCPGWVEKGGSADDPPVRPPRGG
APVERISLVPYAQAPLRVAQFPWARNG

Enzyme Prediction     

No EC number prediction in MGYG000004153_02020.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	124	526	2.4e-37	0.7576335877862596

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.18e-50	71	527	62	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	5.94e-28	80	528	76	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJE95537.1	2.68e-135	2	622	25	646
AOM80627.1	1.05e-115	6	622	23	643
AMP98056.1	1.70e-115	7	622	30	649
QNN43859.1	1.70e-114	7	622	28	647
ATP55412.1	1.99e-113	6	622	29	649

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	4.05e-26	72	528	82	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	5.27e-25	72	528	82	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	4.94e-10	299	528	375	608	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
6YQH_AAA	6.97e-10	292	527	324	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.64e-09	292	527	324	560	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000014	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004153_02020.