CAZyme Information: MGYG000004155_00796

Basic Information

• Species: CAG-273 sp003534295
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-273; CAG-273 sp003534295
• CAZyme ID: MGYG000004155_00796
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233		26527.71	6.4824

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004155	1330798	MAG	United Kingdom	Europe

• Gene Location: Start: 13463; End: 14164 Strand: +

Full Sequence      

MKIFKKILIFLLFCVLIIISILYFKGYKLYKDSIDEVSLTNMVTKLQTDNNYVSIDSLPD
YYKNAVIAVEDHRFEKHGAIDFIAIGRAIVRNVSNFKLLEGGSTITQQVANNLYFIDTDT
PALIRKVAEIFVAFDLEKQYSKKQILELYVNTIYFGDGYYGIKEACNGYLTKEPQEMTLY
EATMLAGIPNAPSVYAPTQNPDLTKSRQKKVIQSMVKYGYLSEDEANKLIGVD

Enzyme Prediction     

No EC number prediction in MGYG000004155_00796.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	45	216	2.4e-57	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	2.39e-70	52	216	15	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	9.22e-66	2	230	13	255	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.36e-63	1	228	2	243	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	9.39e-45	2	227	6	226	glycosyltransferase; Provisional
COG4953	PbpC	3.54e-37	53	226	61	231	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO38940.1	7.86e-76	26	230	30	232
QRP41835.1	1.63e-73	25	232	28	233
ASN93505.1	1.63e-73	25	232	28	233
QIX92252.1	2.31e-73	25	232	28	233
ANU46909.1	9.31e-73	25	232	28	233

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	3.93e-40	52	230	22	198	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	7.84e-40	52	230	22	198	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
3HZS_A	2.40e-34	22	225	2	200	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	2.47e-34	22	225	3	201	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]
5ZZK_A	1.22e-33	19	225	35	236	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	2.76e-41	43	226	59	241	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
Q07259	1.58e-37	43	225	40	219	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
P39793	4.17e-36	52	228	97	272	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
O66874	4.58e-36	52	230	65	241	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
O87579	4.58e-35	52	217	70	233	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.987141	0.008616	0.003712	0.000049	0.000025	0.000476

TMHMM  Annotations     

start	end
7	24