CAZyme Information: MGYG000004157_01188

Basic Information

• Species: HGM11514 sp900757255
• Lineage: Bacteria; Firmicutes_A; Clostridia; HGM11514; HGM11514; HGM11514; HGM11514 sp900757255
• CAZyme ID: MGYG000004157_01188
• CAZy Family: GH116
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853	MGYG000004157_32|CGC1	96506.29	4.8409

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004157	2480742	MAG	United Kingdom	Europe

• Gene Location: Start: 6650; End: 9211 Strand: +

Full Sequence      

MAVYQGEQLNEIIFPLGGIGSGSIGLAGNGRFTDWEIFNHPFKGSTNGYTHFAVRAVGKD
GKVYSKILQGDLTKDFMGQFGAGKYKTDDYSGYGFGPSGKTMAGFPHFGHLSFKGEFPIA
ELTFEDENFPGVIKLTAFNPFIPLDEDNSSIPAAFFKIEIENHTGEDYSYMVSLSVTNPF
EGSENKTVSAGKCKGLFMNGSIKDKTDKDYGDMTVLTDGENTHVQKYWYRGGWQDSVTTY
ANELFSDGQFKDRHYDTPGSEDTGTVSCQSNVPDGETFSVKFVISWNIPNCYNYWSPCKD
DKGKDMTWQNYYAVLFENSEKSAEYALTHFTALYEKTLLFKDTLFGTTIDQTVKEAVSAT
ISVLKSATVLRLPDGSFYGWEGTKQSTGSCEGTCTHVWNYNYALPFLFPKLEQSIHKLNY
QYNLFEDGHMRFRLQLPLGREGGRDIPCVDGQMGEIMNVYREWKLGAGDEWLKSIWPKVK
KSLKYAWYQESPYKWDVNRDGVLEGRQHHTLDMELFGPSSWLQGFYLGALRAAAEIAEYL
GEHEEAKEYRNIYESGKNWTEKNLFNGSFYIQKTDICDKSILTEFDAEHYWNEEAGQIKY
QIASGCEIDQICAQWHADIMGLGDIYDPENRKKALQALYQYNFKKSMREFVNPWRIFALN
DESGTIMCSYPEGVQKPAVPVPYCEETMHGFEYEFAGLLMSHGEIEKGLEVVRSVRDRYN
GKNRNPWCEIECGGNYARSMASYALIPILSGFEFDLPKKLIGFNPAVHSSHFSTIWSTAT
AWGKAETCEDGFELTAYAGTLDVNQISLPFIKNIAFVLCDGKEIESELKDGIVYLKIQNE
ITASLMIKCNTES

Enzyme Prediction     

No EC number prediction in MGYG000004157_01188.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	450	745	1.2e-57	0.7245179063360881

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12215	Glyco_hydr_116N	1.67e-40	27	333	15	309	beta-glucosidase 2, glycosyl-hydrolase family 116 N-term. This domain is found in bacteria, archaea and eukaryotes. This domain is typically between 320 to 354 amino acids in length. This domain is found associated with pfam04685. It is found just after the extreme N-terminus. The N-terminal is thought to be the luminal domain while the C terminal is the cytosolic domain. The catalytic domain of GBA-2 is unknown. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335 in the downstream family pfam04685.
pfam04685	DUF608	1.86e-38	390	745	6	362	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
COG4354	COG4354	2.01e-35	113	752	92	720	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
COG3459	COG3459	2.80e-05	517	674	754	888	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE95836.1	9.91e-310	3	813	7	837
QUH30377.1	8.78e-302	1	852	1	859
QGQ98507.1	8.73e-300	4	814	6	827
QHW31016.1	2.85e-298	3	821	4	834
CCO21811.1	1.41e-297	4	806	6	822

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7W2V_A	2.40e-21	15	740	102	817	ChainA, Glucosylceramidase [Thermoanaerobacterium xylanolyticum LX-11]
5FJS_A	8.87e-21	15	740	55	770	Bacterialbeta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5FJS_B Bacterial beta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5O0S_A Crystal structure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with unreacted beta Cyclophellitol Cyclosulfate probe ME711 [Thermoanaerobacterium xylanolyticum LX-11]
5NPF_A	9.01e-21	15	740	58	773	Crystalstructure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with beta Cyclophellitol Cyclosulfate probe ME594 [Thermoanaerobacterium xylanolyticum]
5BVU_A	9.02e-21	15	740	59	774	Crystalstructure of Thermoanaerobacterium xylolyticum GH116 beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],5BX2_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with 2-deoxy-2-fluoroglucoside [Thermoanaerobacterium xylanolyticum LX-11],5BX3_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with deoxynojirimycin [Thermoanaerobacterium xylanolyticum LX-11],5BX4_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with Glucoimidazole [Thermoanaerobacterium xylanolyticum LX-11],5BX5_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with glucose [Thermoanaerobacterium xylanolyticum LX-11],5NCX_A Crystal structure of Thermoanaerobacterium xylolyticum GH116 beta-glucosidase with an covalent inhibitor [Thermoanaerobacterium xylanolyticum LX-11],5OST_A Beta-glucosidase from Thermoanaerobacterium xylolyticum GH116 in complex with Gluco-1H-imidazole [Thermoanaerobacterium xylanolyticum LX-11]
7DKS_A	9.02e-21	15	740	59	774	ChainA, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKT_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKU_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKV_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q69ZF3	3.09e-12	15	741	144	867	Non-lysosomal glucosylceramidase OS=Mus musculus OX=10090 GN=Gba2 PE=1 SV=2
Q5M868	8.19e-11	15	741	144	867	Non-lysosomal glucosylceramidase OS=Rattus norvegicus OX=10116 GN=Gba2 PE=2 SV=2
Q9HCG7	2.46e-10	15	741	153	876	Non-lysosomal glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004157_01188.