CAZyme Information: MGYG000004157_01662

Basic Information

• Species: HGM11514 sp900757255
• Lineage: Bacteria; Firmicutes_A; Clostridia; HGM11514; HGM11514; HGM11514; HGM11514 sp900757255
• CAZyme ID: MGYG000004157_01662
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1731		186823.76	4.3168

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004157	2480742	MAG	United Kingdom	Europe

• Gene Location: Start: 2339; End: 7534 Strand: +

Full Sequence      

MEMKVSTGWMQKISILVLAAMLFSIVAGFLPGGMFAKAEGEQIWRYTDNISSLTAEPEGT
LIDVSQNYSSAKTTFYGSTSYTDAAANTGNSYLVGQTFINEPAKGNQKSLSANITLTDGA
GTYKVEFYNPLTNASNDAAAKFDITGKDGQVTTVNNVNTGTAGWVTLAESVELDATVTVK
GTGMTTGKNIRYDSIRFTKDGTDQPDEPVEDTIYKFYDAWKANSADITSKVGITDGYKAD
EVNTSTAVQPGDSTVGTKYFNLKSTANVQNMNLVANNVQLPKSGNYVVSLYNPMGDGPNP
GNASQMIYHTDQGKIIITDKNGTVADTTFDFTQECGWYEIGTYSFDASEPIKIEFIEPDA
GDNMRIDAMKFVYTTEDIPAASANPTLTPSAGPVDTKIYDNNDPSGDTEVELILPPDTPP
GADVGSSGTGNVSVNATHGYCSLFNSSAVYTLKNTSSGKFKVEFIVPLVHSNNTNEMYVE
VKDSTGKVVRKVFDIRDANSNGTSASGIQTGDWISMGEDFVFYNSNAPVVTFGKGAPGEQ
VGVSDTGTPIYSNNGHFRYDGVRITRVADVESVPLAVNMKIEGKIAPNEVLTGSYDYVSD
DSASVEGASVIKWYTKSSEDGEYTLQQEKTKNDADCLKYTLKENELFIKMEVLPKDAEGK
EGPKAEFELGAVLPKVKNVAIEGRLRPGAELKGSYEYVHDNGTAEKDSVYTWFAKAKEGD
DYTQVAQGTTTAEQGASYITKPGERFIKLEITPKCDTSVSSLVTGETAFAEFDVVNDKDS
APVAENLVIQGEAVALGQLTAQYTFTDINKDLEKDSEYKWLAASSENAAEWRVLASGKGT
ASDAITYQIPESFPAGDYIKLELTPKSDAGEQMTGKTVTSNVIGPVVIAAIKPEVKDAAF
GGHSVAAEGIEGLATNGEAEIVYTYVNKTGIAEDTEKTQFQWYVSDNSSKGFEPIDGATS
RTYTVPESMKGKFIKVGIVPHAVDGTVGTETFTNAEQVKYNLAFYDDFDYTAADGYDEHF
RTMWTPDAALRELSGIKSARIPENVKVEDGKMIILNRKEHNDKYNFEHTWTTASINSKDT
YGPYGYYEASYKYAWGTGMNQSFWTIGGGNKYNGPDQPQMVELDFNEGHFPRDMASNLHY
FSENNSRITNSIHRYPIGANDYYNIEGPTLADNFNIYGGYFKPNDPNYDWNAKQNQDTFQ
VFFNNDQIRSTQSLPYDNVAEQKIIFSIAIYPGFGGPLYETETGDPNKPTADGTQMEIEY
VRYYELLDVSHETLSGAISLGESIVAETEVGSGFLQCPKATMDSLINAIATAKSVLNNPS
ATEIEKNAQAALVNNAIYFVNRGLNTKGNVSEGKTYDLTDITSALAPTIPRDVANCTFVF
PEAALNQISITVQATGQEIMIPKGTRLSGTFTVPQSISYTADGITVKSAVSSCNLTAQEG
LIQIKLSGAQGYKVAALENGQLREITKQISENTLGAATSAIGTANEVIVYADGSAYVWAK
AAGSYVVYKDAAAEPSPTPTPDYGGGNGNNGGGNYPGGGGYIPMPKPSDSGNKVNFTDIS
GHWAENTIRSLAQDGIIKGKSESIFAPDDNMTRAEFAALIRRAVGLNPSIYQGGFTDVSD
SAWYANEIQAIVNAGIMSGDADGNFRPEDLISREEMAKVAVNAFMYRSGAADVTGVALSF
SDSNEVSGWAVEYVEKAAALNLINGMDDGSFAPNSYMTRAQGTVVISRVIQ

Enzyme Prediction     

No EC number prediction in MGYG000004157_01662.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	1040	1264	2.3e-17	0.8521739130434782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033190	inl_like_NEAT_1	1.17e-20	1554	1721	580	743	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
cd08023	GH16_laminarinase_like	1.16e-17	1004	1264	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02178	GH16_beta_agarase	1.77e-15	1006	1264	27	257	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
cd00413	Glyco_hydrolase_16	6.85e-13	1006	1264	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
NF033190	inl_like_NEAT_1	4.15e-12	1553	1663	640	751	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUI25357.1	7.09e-108	672	1269	662	1285
QHI71623.1	7.00e-69	871	1267	34	410
QKS72634.1	8.60e-31	1555	1730	2061	2236
AFK87257.1	6.30e-30	1555	1730	968	1142
AZK45712.1	1.41e-29	1548	1730	559	742

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AQ1_A	1.45e-12	1555	1730	3	168	Structureof the SbsB S-layer protein of Geobacillus stearothermophilus PV72p2 in complex with nanobody KB6 [Geobacillus stearothermophilus]
4AQ1_C	1.45e-12	1555	1730	3	168	Structureof the SbsB S-layer protein of Geobacillus stearothermophilus PV72p2 in complex with nanobody KB6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38535	1.80e-29	1546	1731	897	1082	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
P38536	4.01e-28	1556	1731	1682	1856	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P19424	1.66e-23	1541	1730	23	214	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1
C6CRV0	1.00e-17	1563	1729	1291	1458	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
P36917	1.54e-17	1546	1658	1045	1157	Endo-1,4-beta-xylanase A OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.647563	0.345090	0.003676	0.000782	0.000572	0.002325

TMHMM  Annotations     

start	end
13	35