CAZyme Information: MGYG000004158_00234

Basic Information

• Species: Dialister invisus
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister invisus
• CAZyme ID: MGYG000004158_00234
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide heptosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		36813.18	9.8472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004158	1763641	MAG	United Kingdom	Europe

• Gene Location: Start: 234117; End: 235106 Strand: -

Full Sequence      

MKDYKNILVIKMSSLGDIIHALPSLYALRELFPDACITWAIHESFAKILPGKPWIDNVYV
IDRKRIKKINYLLQVRKDLHKKQFDLVIDLQMIAKSGLISFLTGCHERIGYNDARECSGL
FSRAISGKYKNGHIIEQLLDVIRYLGWQGSGIHFPLHDYKNELSVVRKKLSEAGVIGKYV
LLVPGTRGENKKWPIGYWGELAKRLAKKGIFCIISGTVGERPMADEIRRIAQSKYVVDFM
GKTNLLELIALERMAAVHVSSDTGPLHIANAVGTPIIALFGPTLPYRSGPYGKRYSEVLL
AENPGHGATNMGTISVEAVYDSCMKKLSL

Enzyme Prediction     

No EC number prediction in MGYG000004158_00234.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	74	294	8.3e-51	0.8577777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	7.37e-68	5	319	2	322	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.57e-63	6	321	1	273	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	6.84e-37	73	306	2	235	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	3.13e-31	2	283	3	291	lipopolysaccharide core biosynthesis protein; Provisional
PRK10964	PRK10964	4.70e-26	7	329	3	322	lipopolysaccharide heptosyltransferase RfaC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK25036.1	5.93e-139	2	329	4	326
AOH38976.1	2.63e-134	4	326	2	324
BBU34623.1	2.43e-99	1	301	1	301
BBU36545.1	2.43e-99	1	301	1	301
ARF99101.1	3.44e-99	1	321	1	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	3.79e-24	7	329	3	325	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
2H1F_A	4.27e-24	7	329	3	325	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]
6DFE_A	5.22e-24	7	329	3	325	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
3TOV_A	8.55e-22	3	291	7	298	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
1PSW_A	6.26e-11	7	285	3	292	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26469	9.03e-23	7	316	3	312	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2
Q57336	1.01e-22	5	291	9	292	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P24173	2.44e-22	7	293	3	292	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
P25742	1.70e-21	16	283	5	279	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	1.35e-19	16	283	5	279	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004158_00234.