CAZyme Information: MGYG000004158_00524

Basic Information

• Species: Dialister invisus
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister invisus
• CAZyme ID: MGYG000004158_00524
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527	MGYG000004158_2|CGC3	60112.89	8.6201

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004158	1763641	MAG	United Kingdom	Europe

• Gene Location: Start: 186051; End: 187634 Strand: +

Full Sequence      

MKNKNAFLIFVFALLLYGLFSDIIPLVDPDEPVYGETAKEMLLTGDWLSPRIYGEYWYDK
PPLFYWLDAVSFSVFGVSTFAARFPSAIIGACTASYLYLFTRKLIGEKPALTGAFICATS
LEIIVLARSAVTDTTLVFALTVALISFLRKEYIPAYMACGLAFLTKGPIGFGFPALIVAL
WMMITKSFTLKNIIALKWYWGIPLACLIGFPWFIYMAMHHGPVFMDTFFGYHNLARFFSP
EHVGKNHLWLFFIVLAAGFYPWTGSIPGIFRHFPEWRKDRTLLFFYVWTVFIFIFFSFSS
TQLFSYILPMFPPLSLLAGKYMVNLEETGHISKLFLYTHLFFSLIIAVAIACAPIAPDAG
KWSQWCVSAAMLAAGLIAAYFFKKGRFKDFLICQGFIVSCFVFSVWFTFGVTVTQLFTSE
SIALELKKNCPGNESVYIDAFYRPSVAFYGDIYGKILPKFDEENFEEAIKNREKGIILPT
DSIDRDIEKGAYILVQEKVYNRWPKTQKAGLQLIWKKDTALFLRKES

Enzyme Prediction     

No EC number prediction in MGYG000004158_00524.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	467	5.3e-110	0.8962962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.32e-49	1	319	5	333	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	4.76e-34	1	354	3	368	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.62e-17	59	215	1	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.45e-14	8	217	2	235	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	1.04e-06	1	236	12	257	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24580.1	1.72e-221	4	525	5	527
AOH39317.1	1.59e-198	2	526	5	528
ALG41392.1	3.30e-105	1	494	6	500
AVO26796.1	4.66e-105	1	494	6	500
AVO73979.1	2.60e-104	1	494	6	500

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	6.84e-30	13	319	41	361	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.26e-32	1	475	2	457	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
C5BDQ8	2.19e-32	29	329	30	340	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
Q1C744	1.02e-31	1	321	4	333	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=arnT PE=3 SV=1
B2K5L1	1.02e-31	1	321	4	333	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=arnT PE=3 SV=1
Q8ZDX9	1.02e-31	1	321	4	333	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis OX=632 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.993966	0.005997	0.000019	0.000011	0.000008	0.000016

TMHMM  Annotations     

start	end
7	26
79	101
125	147
162	184
196	218
248	270
282	299
303	325
334	356
360	382
395	417