CAZyme Information: MGYG000004161_00351

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004161_00351
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
729	MGYG000004161_4|CGC2	79824.89	5.0209

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004161	2198182	MAG	United Kingdom	Europe

• Gene Location: Start: 63084; End: 65273 Strand: +

Full Sequence      

MSESIYTLRVSRAAAGAYPTISDALAAADQLYPDAEQPVMIHVDPDEYRERVEIHRSHVT
IEGETADSVRIVGGLAAQMPSEDGSGQDGKLGTFRTYTVLVDADDVTLANLTIENGAGDG
REVGQAIALYADGDRLVVDACCIKGHQDTLFLGPLPPHEAKPGGFIGPKQYAPRRVGRQY
FRRCRIEGDVDFIFGGARAYFEGCEIRSLNRNMDVNGYVTAASTPEGEPYGFVFHGCSFT
AAQDVAPDSVYLGRPWREWAQTVLIDCWLGRHIKREGWWDWNKPAAHNCAQYAGAILYGP
AGDTTGWVPWANKLDVMAAAGYAREQVLAGADGWDPEGGTGDAVETAGLSANGRTVHIET
YCEDEPALRARLKREGRSAAFAGQTPADFEAWKIATRTRLRDVLGLSLMDRAPIEIRELS
RVQIAGGIVRTHAMLQVERDVWMPFYLLEPQSPKLDARGRKCCYICPHGHQGAGAASVAG
VTGVPAVDDAVRKFNYDYGLRLARMGYVTVCPDARGWGYRRDWKGQGDDENSFLRGTCLN
QARMAEPLGLTVAGLNVWDNMRLIDYLEARGDIAMDDLGCFGFSGGGYMTLYLAALDPRV
CKTFVSGYLYGVDDSLLHLNGNCSCNYTPGLWRLLDMGDIASLIAPRPLLVQSCEEDHLN
GSRGLKNVDEQLEIVRDAYKLLGRRDGLRHEVCPGEHHLGVAHLAEDIEWLDSHVAECAP
VHSPSACCE

Enzyme Prediction     

No EC number prediction in MGYG000004161_00351.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	329	3.8e-78	0.9826388888888888
CE19	435	698	6.5e-27	0.6536144578313253

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	3.81e-63	6	314	81	388	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.83e-52	16	311	10	275	Pectinesterase.
PLN02432	PLN02432	2.70e-41	1	334	7	291	putative pectinesterase
PLN02708	PLN02708	3.00e-41	10	336	245	550	Probable pectinesterase/pectinesterase inhibitor
PLN02773	PLN02773	7.93e-40	8	314	7	282	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34433.1	0.0	1	729	1	729
ATP54718.1	0.0	1	719	1	719
QUC03567.1	0.0	8	712	7	706
QIX89293.1	1.52e-100	8	336	17	348
QRP39805.1	3.10e-100	8	336	18	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	8.04e-28	10	310	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	3.28e-25	16	278	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
3UW0_A	4.15e-25	18	283	44	305	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1C_A	6.01e-25	16	278	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	5.82e-24	18	283	18	281	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	4.28e-35	10	337	260	559	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q43062	1.97e-30	10	310	211	482	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
O81320	9.00e-30	10	328	167	453	Putative pectinesterase/pectinesterase inhibitor 38 OS=Arabidopsis thaliana OX=3702 GN=PME38 PE=3 SV=1
O04887	1.01e-29	10	310	205	472	Pectinesterase 2 OS=Citrus sinensis OX=2711 GN=PECS-2.1 PE=2 SV=1
O22256	3.90e-29	16	334	254	546	Probable pectinesterase/pectinesterase inhibitor 20 OS=Arabidopsis thaliana OX=3702 GN=PME20 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004161_00351.