CAZyme Information: MGYG000004164_01036

Basic Information

• Species: UMGS1494 sp900552305
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; UMGS1494; UMGS1494 sp900552305
• CAZyme ID: MGYG000004164_01036
• CAZy Family: CBM9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1324	MGYG000004164_43|CGC1	146247	4.7034

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004164	2287505	MAG	United Kingdom	Europe

• Gene Location: Start: 4956; End: 8930 Strand: -

Full Sequence      

MKKGFIKRIAIAIAALQLCGASAYAGGSPAGTVYKIQPEFYDSATKEYIDNGVVLRIGNT
QGFVKGLRTDMDESFYEIMPRIIDGESYVPLEYTLTGLGASVTKVSDKEYNVTAGGKNFT
IRADEPLAEGSTHNVKYLLKCMYAPAADVAKVLGKYVYDDKELIIISENSAIENPNKSII
EKLKSSTEFRFGRMYLGAEGFVCGIIEHPLDPDIKYTRTDVGGVYRWNPESRTFKQLSMV
IPYEERNAAGGVLGFAVDPNNKDVIWASMGTFKGLTGCGIFKSSDRGESWTKMLDVLCYG
TASRVTGESIAVDPNNSDIVYVGTIEDGLWITKDGGKSWTQNTSIQKAAEGYEVNAILVD
PSKKDEAGNSAHVYVSTIGKGLFETNDSGKSFTHVADSPEQPQRMQICDGYLFLSAAVKP
KSSLVKNDCNGGFFKYKNGKWIDITPPLPNNNATYKNGVTGFMIDRTNHDVIITGGEAWA
GMGGWFARTLDGGKTWEKFKWYGTSTIMQDGNNPQQMWVCTGESQDLFTDIYADIVDYKL
PSYREEKGIEEPVDLKILSTGDPKAPMLFVNMYDRGFGWCENMYRKATYQHHVGKILGLG
VSIDYCRSDARYIARIGRSQDNGGQNYIGLSDVYGRRWDISYSWPVNKPAVSIAVSATKQ
ENGYPVLLVGTSNKDTGGKGKIYRSLDWGKTWDEAQGFDIMLNDTSFETAYRNYLLVADA
VDGKTFYYCESDDFYVSHDYGATWSIAGTMPHSNWLSDFHAVPGKEGWVYATRDGNMLRT
TNGGATWNKITTITGLKYLSFGKGKPGGENPALYALGVINGVRGLWLSDDMGETWRRVDD
SSKNYFMYEDTQIAGDMGVYGRVFVSLSGAGVIYFQKTDVDNTPPEITVDNTSSAAEYGL
DYAVSEPVVKVSGALNEPGEVRINNMPAAVGDDFKFSLDVTLKEGENDILIEAADERGNK
SESKHLSVRYIPGFLGLVLDGQHEISTKEDSLVITGKTTGSAMVYVNGIEAAKTDADNSF
KIDYKLTQAEQTLKVTAKTESGRVSREDDVIVHKDNTPPTATLNIPEGQVEKRIFTLNGV
LSEKGEVRIDGLDVRVNDDLSFSTILLLDQANTQVKVQYKDIAGNVSKPMSYDIKRDMSK
AVDKTRLTVPYRSNDFVFDGDTSEWNLAYDLDEPFYGEENNTCAFNLMWDEENLYVGVKV
KDKVIYTDHVTDYVNDCIEVFIDGNNTKGDSYDRNCAQLIYVANGKSPFAPIKVTEDGYT
MEIKIPWSNVGIAPTAGHLFGLDIDNVNNDGALTNNERGGVIGFNGTISDWCNPKPWTTF
ELVK

Enzyme Prediction     

No EC number prediction in MGYG000004164_01036.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	1178	1322	7.2e-25	0.8571428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09619	CBM9_like_4	1.09e-20	1157	1314	3	183	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
pfam06452	CBM9_1	1.61e-20	1163	1323	7	182	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
cd00005	CBM9_like_1	4.84e-17	1187	1323	43	185	DOMON-like type 9 carbohydrate binding module of xylanases. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. The CBM9 domain frequently occurs in tandem repeats; members found in this subfamily typically co-occur with glycosyl hydrolase family 10 domains and are annotated as endo-1,4-beta-xylanases. CBM9 from Thermotoga maritima xylanase 10A is reported to have specificity for polysaccharide reducing ends.
cd09621	CBM9_like_5	7.11e-09	1177	1320	24	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd00241	DOMON_like	7.86e-08	1171	1284	8	142	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANE48490.1	1.91e-140	188	1311	37	1170
ANE48489.1	3.00e-101	183	1322	32	1112
QJC51548.1	2.52e-74	189	1322	40	1353
QWG03218.1	3.32e-63	189	898	26	739
AFY32698.1	3.51e-63	184	876	49	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P2M_A	2.28e-58	183	874	4	690	ChainA, Type 3a cellulose-binding domain protein [Caldicellulosiruptor lactoaceticus 6A]
4LGN_A	2.62e-53	183	874	1	732	Thestructure of Acidothermus cellulolyticus family 74 glycoside hydrolase [Acidothermus cellulolyticus 11B]
2CN2_A	1.38e-50	197	874	20	728	ChainA, BETA-1,4-XYLOGLUCAN HYDROLASE [Acetivibrio thermocellus],2CN2_B Chain B, BETA-1,4-XYLOGLUCAN HYDROLASE [Acetivibrio thermocellus],2CN2_C Chain C, BETA-1,4-XYLOGLUCAN HYDROLASE [Acetivibrio thermocellus],2CN2_D Chain D, BETA-1,4-XYLOGLUCAN HYDROLASE [Acetivibrio thermocellus]
2CN3_A	1.85e-50	197	874	20	728	ChainA, BETA-1,4-XYLOGLUCAN HYDROLASE [Acetivibrio thermocellus],2CN3_B Chain B, BETA-1,4-XYLOGLUCAN HYDROLASE [Acetivibrio thermocellus]
2EBS_A	1.87e-48	189	879	4	764	ChainA, Oligoxyloglucan reducing end-specific cellobiohydrolase [Geotrichum sp. M128],2EBS_B Chain B, Oligoxyloglucan reducing end-specific cellobiohydrolase [Geotrichum sp. M128]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DFA0	5.34e-51	178	887	27	770	Xyloglucanase Xgh74A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xghA PE=3 SV=1
Q70DK5	5.34e-51	178	887	27	770	Xyloglucanase Xgh74A OS=Acetivibrio thermocellus OX=1515 GN=xghA PE=1 SV=1
Q8J0D2	9.47e-48	178	879	15	787	Oligoxyloglucan reducing end-specific cellobiohydrolase OS=Geotrichum sp. (strain M128) OX=203496 PE=1 SV=1
Q3MUH7	1.51e-47	200	937	50	830	Xyloglucanase OS=Paenibacillus sp. OX=58172 GN=xeg74 PE=1 SV=1
Q5BD38	1.29e-38	189	874	35	805	Oligoxyloglucan-reducing end-specific xyloglucanase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgcA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000276	0.998943	0.000271	0.000184	0.000174	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004164_01036.