CAZyme Information: MGYG000004164_01267

Basic Information

• Species: UMGS1494 sp900552305
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; UMGS1494; UMGS1494 sp900552305
• CAZyme ID: MGYG000004164_01267
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581	MGYG000004164_60|CGC1	66795.15	5.0418

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004164	2287505	MAG	United Kingdom	Europe

• Gene Location: Start: 5094; End: 6839 Strand: -

Full Sequence      

MNIPRNEYPRPQLVRRGWTNLNGEWEFEIDNGKSGIDRKFFERSTLDGKITVPFCPESEL
SGIGSKDFMDCVWYRREFEIPEYAKGRQLILHFGAVDYHAIVYVNGALVGEHKGGYTGFS
FDITKYLKDSGNFITLCAFDNVRSANQPAGKQSDKYYSYGCLYTRTTGIWQTVWLEAVDK
IHIKNIRAVADIDTPSVNLTVKLSEYAPDTIVCAKALWNGKCVGEGSVRAFSSCAVLDIR
LSEKHLWKLGEGNLYDLELCVSRGGKVCDEVTSYFGLRSVALEGKKFTLNGEPVFGRWVL
DQGFYPDGIYTAPTDEALKNDILYSMQLGFNGARLHEKIFEERFLYHADKLGYMVWGEHA
NWQLDISDAGQIRHFLPEWIESVERDFSHPSIIGWCPFNETWDREGREQDNSVLLNVYLV
TKALDPTRPVIDTSGNFHVLTDIFDVHDYEQNPEKFRSYYEKISEGIVNDQINRNPHLKH
RQTYDGVLPVFVSEYGGIRWTDKASDGWGYGEAPKTREEFIDRYRGLTDALLDNPEIMGF
CYTQLYDVEQEINGLMTYERQFKFDPDIFKEINTRKAAIEK

Enzyme Prediction     

No EC number prediction in MGYG000004164_01267.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	14	468	9.7e-98	0.5159574468085106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	3.42e-49	10	430	3	445	beta-D-glucuronidase; Provisional
COG3250	LacZ	2.43e-46	21	454	15	451	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.43e-21	16	430	39	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	5.91e-19	21	175	4	165	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PRK09525	lacZ	3.97e-10	74	430	124	485	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY74929.1	2.18e-252	2	580	6	581
QHQ60389.1	1.60e-249	2	580	3	570
QOT10821.1	1.80e-248	1	580	4	579
AWP26385.1	3.62e-248	3	580	6	579
ACX67002.1	7.28e-248	1	580	4	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.54e-88	7	575	28	581	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
3K4A_A	3.63e-32	21	496	17	508	Crystalstructure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12],3K4A_B Crystal structure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12]
4JHZ_A	6.48e-32	21	496	17	508	Structureof E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12],4JHZ_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12]
3LPF_A	6.57e-32	21	496	17	508	Structureof E. coli beta-Glucuronidase bound with a novel, potent inhibitor 1-((6,7-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(3-methoxyphenyl)thiourea [Escherichia coli K-12],3LPF_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 1-((6,7-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(3-methoxyphenyl)thiourea [Escherichia coli K-12],3LPG_A Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)urea [Escherichia coli K-12],3LPG_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)urea [Escherichia coli K-12],5CZK_A Structure of E. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea [Escherichia coli K-12],5CZK_B Structure of E. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea [Escherichia coli K-12]
6LEM_B	2.10e-31	21	496	13	504	ChainB, Beta-D-glucuronidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	3.41e-33	66	454	52	438	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
P05804	1.16e-30	21	496	15	506	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
P26257	8.47e-28	21	506	7	474	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
Q4FAT7	2.19e-23	8	430	30	479	Beta-glucuronidase OS=Sus scrofa OX=9823 GN=GUSB PE=3 SV=1
A7LXS9	3.03e-23	19	449	45	521	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004164_01267.