CAZyme Information: MGYG000004166_00135

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000004166_00135
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1505		169917.38	5.1

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004166	2603762	MAG	United Kingdom	Europe

• Gene Location: Start: 169823; End: 174340 Strand: +

Full Sequence      

MKRITTLFAIAIAASSVSVSAAGPKASDFVPYKTNELRLPSVPLLINDPFFSIWSNYDAL
NAGPTTHWSEHEKALNGILRVDGTAYRFMGPERSNVLVPIAGMTVDGADWYGRVNYTPMT
GTAWAQPGFDDNSWKTERAAWGTAGEYPNVNNVWKGDNKDIYVRRTVNLSAEDLKKNLAV
QYSHDDVFELYINGKRVVSTGETWRQGEITNLSDTQKGWLKEGENVIAAHCHNTSGGSYI
DFGLYENLIQSSDAMQMARQNSCDVMATSTYYNFTCGPVNFDVVFTAPMLIDNPDLISTP
INYISYQVKSSDGKKHDVQFYLSASPQFTVNEMTQPTLSSIVNENGVRYLKSGSEEQNYC
GRTGDMITIDWGYLYIPAINGDIAIANQLDAERAFVADGKLPQSASGTVRSTSHATMPAL
AFVNDLGKVSEARDYMMIGYDEVYDMEYMHKKYKAYYARNGKTIFQAFDEFKRDYNDLMK
RSKELDKRIYDDALAAGNVKYAEMLAANYRLVMGAHKVFQDDKGHMLYFSKENKSGGFVN
TVDLTYPECPIYLLYNPELQKGMMFSIFDYALSPERAGKNCAAHDLGIYPQANGMHYGDS
MPLEESANMIILANAICRITGDGEWLKPYAKVLRTWAEYCRENGQNPGRQLCTDDFKGPS
EQNTNLSLKAITAVGAYAELAKYIGDKDADSFAESAKNMALLWEADARDGDHYRMEFHRP
GTWSQKYNLVWDRMWGYNYFPAEIIDREINFYLNHQQKYGLPLDSRDMQTKSDWIFWTAS
LSPDTDTFLRFSDLHWKYMNETPSRIPLSDFYLADRGTSCNFSGRSVIGGLWIKILKDRI
QPAPAQTAWEPKGNHMKTRWVADVNPDCPLPEYPRPIMVRNDWMNLNGLWDYAITDGGTP
AAYDGKILVPYPIESSLSGVMRPLEPGKTLWYKREVNIPSSWNGKRIILNFGAVDYDADV
YVNGVTGRYLVASHKGGHSAFSADITNKLKSGANTIYVKVVDKTDENGQPVGKQRRYPNG
GGDIFYTSTSGIWQTVWLEPVESTYAESIRITPDVDNSTISFLPVIKDGNGATVYVTLKD
GDNVVASKSGAAGETIVLDVPGAKLWSPDSPFLYNVEVSVDKNGKTVDAFGSYAAMRKIS
YAKNEAGFWRLQLNNKDLFQFGLLDQGYWPDGLLTAPTDEALRYDIEKTKEWGFNMIRKH
MKTEPARWYRHCDELGILVWQDMPAVYRSDENWVTETWYPEHACSQDPTVEKNFRNEWTE
IIDQLYSYPCIVVWTPFNEHWGQFKTAEIVAFTQSLDNTRLINPASGGNHYRLGEGTIVD
QHTYAQPIRVFEGIFDPSRPLVLGEYGGLGRNIKGHRWFERDAQTYNTYPSERSITDAFD
RLSSQIRDIAEGYESEAGKISYGAAVYTQTTDVETEVNGIMTYDREIVKFNENRLRAAVD
RLTGVYETSGVNDVRIEPFEGDTVYYNINGVSSNRPFNGFNIIKDSNGRTHKVMFTSAES
DNEKI

Enzyme Prediction     

No EC number prediction in MGYG000004166_00135.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	879	1317	4.7e-95	0.49069148936170215

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16335	DUF4965	6.75e-64	496	666	1	174	Domain of unknown function (DUF4965). This family consists of uncharacterized proteins around 840 residues in length and is mainly found in various Bacteroides species. Several proteins in this family are annotated as Glutaminases, but the function of this protein is unknown.
pfam17168	DUF5127	4.42e-62	268	492	1	226	Domain of unknown function (DUF5127).
pfam08760	DUF1793	8.53e-60	673	836	2	169	Domain of unknown function (DUF1793). This presumed domain is found at the C-terminus of a glutaminase protein from fungi. This domain is also found as a single domain protein in Bacteroides thetaiotaomicron.
COG3250	LacZ	1.18e-41	886	1303	15	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.75e-30	885	1300	14	443	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA48091.1	8.36e-244	155	839	11	700
AHW60263.1	4.68e-205	849	1436	21	591
QIA07412.1	1.26e-200	849	1436	21	591
SCM57946.1	4.75e-200	849	1436	21	591
QIK54436.1	7.51e-198	849	1438	21	592

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.32e-183	849	1442	5	582	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6ED1_A	1.65e-26	931	1301	80	448	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
4JKM_A	7.23e-24	884	1297	16	438	CrystalStructure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]
5UJ6_A	8.97e-24	929	1347	77	520	CrystalStructure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D50_A	9.07e-24	929	1347	85	528	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2U4L7	3.78e-60	260	836	97	689	Glutaminase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gtaA PE=1 SV=2
D4AMT2	1.75e-32	492	830	350	777	Probable glutaminase ARB_05535/05536 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05535/05536 PE=1 SV=2
T2KPJ7	5.72e-28	931	1281	106	433	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	3.81e-23	931	1411	59	505	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KM09	2.98e-22	931	1307	109	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000236	0.999079	0.000159	0.000178	0.000162	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004166_00135.