CAZyme Information: MGYG000004166_00352

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000004166_00352
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	MGYG000004166_3|CGC1	39443.69	4.4305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004166	2603762	MAG	United Kingdom	Europe

• Gene Location: Start: 2694; End: 3761 Strand: -

Full Sequence      

MTSILSAISLAMAIATTTACTEDSPVTNPMPQPEEVVRETGFAYGADVSWITELENKGEK
FYTPGSDRQEMECMQLLRDHCGVNSIRLRVWVNPKDGWNNIDDVVVKARRADRLGQRVMI
DFHFSDTWADPGHQEMPEAWKGLSFEEQKAALAAHVTQTLEALKAVGISPAWVQIGNETT
PGMMLPVGSVDNPVQLTQLNNAGYDAVKAVCPEALVIVHLDSGNNQWIYDRMFDILETNG
GKYDMIGMSLYPYWAEQNGETGGWRKVATDCIANVNHVKTKYNKPVMICEIGMPYDQGAT
CKELIKLVMTADVEGIFYWEPEAPEDYNDGYKLGCFQNGAPNEALEAFVEAKAKK

Enzyme Prediction     

No EC number prediction in MGYG000004166_00352.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	44	332	6.4e-88	0.9152046783625731

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	1.49e-92	45	348	3	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	4.65e-82	33	333	31	355	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT70301.1	1.57e-201	3	348	5	350
QMW86976.1	2.23e-201	3	348	5	350
AAO79773.1	2.23e-201	3	348	5	350
QUT42647.1	6.39e-201	3	348	5	350
BCA49296.1	6.39e-201	3	348	5	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GP5_A	8.72e-200	22	348	22	349	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],6GP5_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6GPA_A	1.33e-194	36	348	1	313	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482],6GPA_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482]
1R8L_A	1.43e-40	42	321	24	322	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	1.04e-39	42	321	24	322	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
1HJS_A	8.21e-35	45	321	6	298	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	9.67e-43	37	295	1	254	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
Q65CX5	1.25e-39	42	321	49	347	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
O07013	1.38e-37	42	321	53	351	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
P83692	4.50e-34	45	321	6	298	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1
A1D3T4	7.26e-33	45	321	27	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000115	0.101034	0.898726	0.000038	0.000045	0.000038

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004166_00352.