CAZyme Information: MGYG000004166_01696

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000004166_01696
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000004166_23|CGC1	42061.93	9.3639

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004166	2603762	MAG	United Kingdom	Europe

• Gene Location: Start: 25030; End: 26172 Strand: -

Full Sequence      

MHYFLIAGEASGDLHAAHVIEELRKKDSNAVFTFLGGDRMAAAAGEAPIVHYRKMAFMGF
TEVIKNIGTVTSNLRKAKEALELAGPDALILVDYPSFNLKIAAKAKKLGIPVYYYISPKI
WAWKKWRIKDIKRYVRRMLSILPFEPAYYKENGFEATYVGNPSVGEVDAGLATALPRTEF
LEKWKLRDRPLVALMPGSRRAEIRSNLAVMRLAVDRFPQYRGVIIAAPGIEDEFYNANGG
INMPILREKCAEHVLAHCRAALVTSGTATLETALSGVPQVACYRSNGAKITYDIMSKVLD
IKYVTLPNLIADEGIIPEMLIHYCTPDLVADKLAPLLRLDSAERAAQLEGYQRMRRALGT
SDAAATAADIIFGDIKNPRS

Enzyme Prediction     

No EC number prediction in MGYG000004166_01696.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	358	8.7e-109	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.13e-104	1	358	2	359	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.10e-99	4	372	5	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.70e-75	4	359	2	359	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.04e-64	5	359	10	370	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.06e-48	1	327	2	307	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR08529.1	4.65e-135	1	371	1	370
ASB37800.1	4.65e-135	1	371	1	370
ANU64105.1	4.65e-135	1	371	1	370
QCD36425.1	5.14e-133	1	379	1	378
QCP71596.1	3.82e-117	1	372	1	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	7.06e-35	5	337	11	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.61e-34	5	337	11	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	2.04e-69	5	372	9	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	9.48e-60	5	372	11	377	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q3JAC1	4.33e-58	5	370	10	373	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1
B8JE78	1.53e-57	5	373	13	380	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	1.53e-57	5	373	13	380	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004166_01696.