CAZyme Information: MGYG000004168_02664

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-11
• CAZyme ID: MGYG000004168_02664
• CAZy Family: PL17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
667	MGYG000004168_23|CGC2	75634.42	5.0123

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004168	4047630	MAG	United Kingdom	Europe

• Gene Location: Start: 46478; End: 48481 Strand: -

Full Sequence      

MLQFSTADIARIKERVKEHPEHLEALRAQTAFFFEHGVKVPVGTQSTWIMNFVCPEDSAT
LRYDYASEFEYVCPVCGKVYSGEPYSGAWWRYTVEKVVDNGFLCAVVWMITGEEKYKNVA
CEILERFAENYSGYELHGGIPYNNPGMINSQTLCEALTIRSLAMAFDIVADAMPAEWRER
IVEKLIVPSANVLCEQRMNQLHNHEVVIDSALGIVGLVTKREDLIDFGVNAKYGLKYQME
HGVLEDGFWFEGTVHYHYFALWACMMFEKFAKNTPYTLRNLGIYEKMYAMPLRLMKPNFH
MPCLGDGNGEGMFEELAEHYEFPYALIHTREMAQLLNKVYTVQKRDGMQALLYGVDEIED
VEPLTLSNYHDNEASGLTVVHGAGEQYLLFKHGKFGGEHDHYDKLGIHYSVGECDVIADF
GTVGYNAPHHYPYFKNTFTHNTVCINGVNQPPADGKTIEYRSGDGETLVQGYAGWVGELP
DRDSLTITQWDEDAYRGVRMNRALLVRDEYIVEAFLVRGADGKTVDWNIHPKGAWAARED
AKPDTVGDSQPQRFLHDAVGVSNHGVVESVWVQDAGTLRVWSGCNCEGRLIYAQGPDNPP
DKTVTYLTHRVEGMRGDILYMNVICFERDGNKLQKVSMSQQDARNVEICVTYDGVERRHA
FSIGQEA

Enzyme Prediction     

No EC number prediction in MGYG000004168_02664.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL17	375	506	7e-38	0.9777777777777777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07940	Hepar_II_III	1.20e-15	370	577	7	211	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
pfam05426	Alginate_lyase	0.002	99	280	59	248	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY69345.1	8.48e-204	1	664	1	668
BAR73165.1	1.57e-137	1	658	1	656
QRV20012.1	2.55e-134	1	624	1	625
ADL05862.1	2.55e-134	1	624	1	625
SET91754.1	4.65e-132	1	639	1	640

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7BJT_A	2.30e-12	85	517	78	549	ChainA, Alginate lyase, family PL17 [Zobellia galactanivorans],7BJT_B Chain B, Alginate lyase, family PL17 [Zobellia galactanivorans]
7BM6_A	1.20e-11	85	517	78	549	ChainA, Alginate lyase, family PL17 [Zobellia galactanivorans],7BM6_B Chain B, Alginate lyase, family PL17 [Zobellia galactanivorans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004168_02664.