CAZyme Information: MGYG000004168_02915

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-11
• CAZyme ID: MGYG000004168_02915
• CAZy Family: GT1
• CAZyme Description: O-mycaminosyltylonolide 6-deoxyallosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434	MGYG000004168_29|CGC1	47830.04	7.5604

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004168	4047630	MAG	United Kingdom	Europe

• Gene Location: Start: 8920; End: 10224 Strand: +

Full Sequence      

MRITMICIGSTGDVRPYIVLGRELRARGHDIAICAFSDFETAVKKEGMRFKPISGDVRTF
MTNIMKPGVNGVSYLKQVRDTLIEFIEPFLHDLESACEDAEAIVATYFGQIIQSIAEVRR
VPFFQTHYFPMDKNAQTPIASAPGQHAGRAWNVATYQLGYLLISTLEKYYLSDWREARGM
SPRKLEGQPTYELNGHTIPVLYAMSPLIMPRPVSWGANIHMTGYWLDDRLTDFTPDPGLL
SFLGDGEPPVYIGFGSMTGNDMGETLAIVLEALRQSGVRAVLSTGWGDVTVPSRPDLYVA
GFVPHDWLFNHVRAVVHHGGAGTTAAGILAGRPTLVIPFGGDQPFWGARVRALGLGPKPI
PRDKLTVAKLSKALTQLTTIKSYRVAARELGERLRKEEGAVTAANIIEHELRKWLREEGL
PPAIVADASAAKQE

Enzyme Prediction     

No EC number prediction in MGYG000004168_02915.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	16	410	6.4e-60	0.9554973821989529

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03784	GT1_Gtf-like	3.10e-61	1	408	1	402	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	3.50e-58	1	413	2	401	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
TIGR01426	MGT	2.10e-22	8	413	3	392	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
pfam03033	Glyco_transf_28	4.86e-07	3	130	1	131	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
PHA03392	egt	6.19e-06	236	395	284	447	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTE68307.1	6.88e-132	1	414	1	414
QAT62528.1	6.21e-115	1	412	1	413
QAT48736.1	9.87e-101	1	414	65	476
BAY41773.1	3.67e-98	1	414	1	422
CAB1252917.1	2.52e-91	1	362	1	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	2.92e-57	5	411	24	439	Sterol3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	4.48e-57	5	411	44	459	Sterol3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	2.97e-39	1	407	1	394	CrystalStructure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	7.93e-35	9	406	9	393	ChimericGlycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	3.31e-33	1	407	1	395	X-raycrystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CYS1	1.42e-72	1	411	911	1328	Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=atg26 PE=3 SV=1
Q4WID6	1.92e-70	1	411	902	1319	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2
Q5B4C9	1.21e-69	1	411	896	1313	Sterol 3-beta-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=atg26 PE=3 SV=1
Q0CKU4	2.23e-69	1	411	898	1315	Sterol 3-beta-glucosyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atg26 PE=3 SV=1
A1CFB3	2.25e-69	1	411	908	1325	Sterol 3-beta-glucosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004168_02915.