CAZyme Information: MGYG000004168_03374

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-11
• CAZyme ID: MGYG000004168_03374
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000004168_40|CGC2	40372.9	6.0631

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004168	4047630	MAG	United Kingdom	Europe

• Gene Location: Start: 23337; End: 24413 Strand: -

Full Sequence      

MIGVSGHCVSQAVAFNPVLANQGVKYLADGKVEICLKIPRNAQQVSLRLLDGKRFELSGQ
GNEIWSGRFDPGFGFHYADVLVDETEVLSPYLPIGFGCSRPINFIDVPIPGEDGFYQPDD
GPHGSVIRHYFPSSVTEELESCLVYQPPQYDPSQAYPVLYLQHGLGENETGWVHQGRANF
ILDRQIHQGAATPMLVVMCSGMVQIHGVYNNDIFPQLLVNDVIPFIEGAYQVKKDKWHRA
MAGLSMGSMHTSIATLSHPELFGYAGIFSGFLHHLWKEEQPHLDALNDADAFKKNYRIFI
RAMGREDSFFSHFQQDDALLAQKGIQTMRRLYDGDHGWQVWRQCLRDFLPLIFKEATI

Enzyme Prediction     

No EC number prediction in MGYG000004168_03374.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	140	350	1.7e-48	0.9383259911894273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	3.01e-34	122	354	65	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	1.79e-17	144	352	12	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	2.25e-11	144	352	39	308	S-formylglutathione hydrolase FrmB [Defense mechanisms].
cd02858	E_set_Esterase_N	1.07e-10	30	108	1	78	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG2819	YbbA	1.12e-08	144	331	27	221	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC66034.1	1.13e-115	13	354	11	361
CBK94454.1	2.38e-85	53	355	65	369
CBK90399.1	1.35e-84	53	355	65	369
AZB25833.1	9.70e-59	27	354	306	641
QIA09957.1	2.95e-58	20	354	14	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZO_A	3.79e-59	15	354	4	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	3.89e-59	15	354	4	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6MOT_A	4.83e-53	29	354	24	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	8.29e-53	29	354	45	380	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
7B5V_A	7.91e-50	6	354	19	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	3.37e-46	13	355	318	671	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	1.08e-39	62	354	434	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P10478	2.91e-23	107	351	31	275	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P31471	1.44e-22	99	354	118	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P51584	6.87e-11	110	355	814	1077	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004168_03374.