CAZyme Information: MGYG000004172_00082

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae
• CAZyme ID: MGYG000004172_00082
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000004172_1|CGC5	43710.78	6.7713

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004172	3050906	MAG	United Kingdom	Europe

• Gene Location: Start: 109369; End: 110490 Strand: +

Full Sequence      

MAESEMRRHPVPYLLDSPKGLPEWNYTTGLEIHAFMDVYNRYGDPAMWDYVLRYADTMIT
DEGDIRRYVLEKYNLDHIKPGTLLFQVYEHTGETKYRKAMDLLRRQLLLQPRTHDGGFWH
KLIYPRQMWLDGLYMGSPFYAMYIARFETGEARTRDFEDVARQFLLMAEHSYDPVTKLYR
HVWDETRTQFWADKTTGLARHSWGRAVGWYLIGIVDALDYIPEGTKGRREMIEIFRNLYR
ELPRYADRQTGMWYQVLELPDRAGNYQEATCSAMITYAMLKGIRMGYLDASLLPQAKKNY
ENLVKTFIRENPDGTISLTRCCEVAGVGGVGTNATRSGTFDYYINEKIRDNDPKGIGPFI
WASLEYEALQDKK

Enzyme Prediction     

No EC number prediction in MGYG000004172_00082.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	22	367	3e-114	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.12e-95	1	370	5	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	5.06e-88	23	369	33	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK63671.1	1.19e-138	1	365	34	395
AVM52204.1	5.68e-138	1	370	38	399
QUT77882.1	3.06e-136	1	372	36	399
QUT93209.1	5.49e-136	1	373	36	400
ALJ61262.1	5.49e-136	1	373	36	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.35e-107	24	369	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	4.08e-71	24	369	39	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.72e-70	24	369	29	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	7.17e-18	112	369	183	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4XUV_A	2.00e-14	19	310	42	327	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.23e-70	24	369	39	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	7.29e-32	135	365	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	7.29e-32	135	365	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	5.39e-13	24	292	29	283	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004172_00082.