CAZyme Information: MGYG000004172_00250

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae
• CAZyme ID: MGYG000004172_00250
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	MGYG000004172_1|CGC11	41552.37	8.0292

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004172	3050906	MAG	United Kingdom	Europe

• Gene Location: Start: 344907; End: 346019 Strand: +

Full Sequence      

MIEKFLLTCAISVTVLSVSAQNSFSGKTDKDNVSAVCNAVAAWQIANHANSRHHQLDWTN
GALYRGMVEWGKTSGNKNCIDFVMKIGKNHNWAMWRRPYHADDICVGQAFIELYRMTGNK
SMLQPVMERAYYVATHPSKAPLLKTDPIGKDERWSWCDALFMAPPVYAALYDITGDKTYA
EYMDSEYRICVDSLYDREEKLFYRDCKRIPLREANGSKQLWGRGNGWVFGGIPLILENLP
QNHPTRFYYIELFKEMAPSILRTQDKNGAWHSSLLDPDSYPLPENSCSAFFCYGLAWGIR
NGYLTDPAYRTALKKGWASLVAGVHSDGKLGYIQPVGAAPKAVGANATDVYGVGAFLLAG
SELYRMDNAK

Enzyme Prediction     

No EC number prediction in MGYG000004172_00250.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	51	365	3.6e-89	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.82e-95	40	366	5	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.90e-59	57	365	35	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48187.1	9.33e-196	17	365	15	363
QDH57430.1	6.22e-195	3	366	2	364
QRQ49255.1	1.52e-192	4	365	2	363
QUT45004.1	4.35e-192	4	365	2	363
QDO70976.1	5.93e-185	24	366	21	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	7.77e-73	43	366	39	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	1.38e-54	43	365	44	373	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	7.55e-51	44	365	18	356	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4XUV_A	7.07e-07	54	330	45	330	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	9.37e-76	10	363	34	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	5.19e-72	43	366	46	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	3.56e-69	43	367	44	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
O31521	1.78e-15	57	334	30	300	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000282	0.999010	0.000216	0.000161	0.000154	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004172_00250.