CAZyme Information: MGYG000004172_00328

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae
• CAZyme ID: MGYG000004172_00328
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804	MGYG000004172_2|CGC1	89011.02	6.3803

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004172	3050906	MAG	United Kingdom	Europe

• Gene Location: Start: 25666; End: 28080 Strand: +

Full Sequence      

MKNFRTLLPALLLGCGFANGSTAQPSADIYRDGWIDFNKNGRKDIYEDPARPVSERVEDL
LSQMTLEEKSCQLATLYGFGRVLKDSLPTPRWKNEVWKDGIANIDEMLNGVGSGLRRAPE
LIVDYAGHVRAKNAVQRWFVEQTRLGIPVEFTNEGIHGLNHSKATPLPAPIGIGSTWNRS
LVRQAGEIAGKEAKALGYKNVYAPILDVVRDPRWGRTLECYGEDPFLIAELGIRMVEGIQ
SQGIASTLKHFAVYSVPKGGRDGNARTDPHVAPRELHEMFLYPFRRVVQEAKPMGVMSSY
NDWNGEPVSASRYFLTELLRHQYGFDGYVVSDSEAVEFIYTKHQVAESYDDAVRQVLEAG
LNVRTHFTPPADFILPIRRLVKAGKLSEEVLDQRVREVLSVKFRLGLFDAPYTDESPESI
GVAGMDKHLDFAREIQRQSMVLLKNEDNTLPLDRKKVKRILVTGPLADESNFMISRYGPN
ALTPVTALQGIRDYVGKDASVSYAKGCEVVDEGWPNTELAATPLSAKERGMIAEAVRQAR
KSDVVIAVLGEDEKRTGESRSRTSLELPGRQQQLLEALHATGVPVVLVLVNGQPLTINWA
DQHIPAILETWFPSVEGGTVIAETLFGENNPGGKLPITFPKSTGQIELNFPYKKGSHGAQ
PVSGPNGAGETRVLGPIYPFGHGLSYTTFAYSDLQVSPKENHAGDKFTVTVKVTNTGDRQ
GDEVVQLYVTDKVSSVVTYTSVLRGFERVSLAPGETRTVTFELHPSHLQLLDRNMNWTVE
PGRFDIMVGASNEDIRLKDTVTVL

Enzyme Prediction     

No EC number prediction in MGYG000004172_00328.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	141	363	1.9e-66	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	57	796	38	758	beta-glucosidase BglX.
PLN03080	PLN03080	4.12e-99	144	765	78	744	Probable beta-xylosidase; Provisional
COG1472	BglX	7.30e-83	128	509	41	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.03e-69	440	686	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.01e-62	133	401	52	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI63350.1	0.0	12	803	9	802
QBN20400.1	0.0	21	804	20	809
AOW08795.1	0.0	21	804	20	804
QJX47921.1	0.0	7	803	11	803
ALJ60238.1	0.0	23	798	27	797

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	3.82e-130	46	796	7	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	2.93e-129	46	796	7	749	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	3.55e-129	40	796	30	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	2.62e-128	140	792	65	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	1.43e-127	140	792	65	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	2.64e-137	144	798	62	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	1.99e-134	57	796	38	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	9.09e-132	57	796	38	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	9.10e-119	46	796	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P14002	2.22e-99	144	803	34	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000791	0.687923	0.310403	0.000298	0.000313	0.000259

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004172_00328.