CAZyme Information: MGYG000004172_00458

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae
• CAZyme ID: MGYG000004172_00458
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272		32237.76	6.8171

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004172	3050906	MAG	United Kingdom	Europe

• Gene Location: Start: 178017; End: 178835 Strand: -

Full Sequence      

MIPKIIHYCWLSGEEKPQRILDCIESWRRVMPDYEIVCWDMERFDIHSVPWVEQACKHGK
WAFAADYIRLYALYHCGGIYLDSDVRVLKRFDPYLEHRAFGGIELWEDHLIWKKNEGTFD
SLVMSGNTGINIEAAIMGAEKGHPVFRAFLDYYEGRSFVPEKIGEYVMPWLLSRTAFRFG
FRNDEYRYPQVLEHDYHLYPYDYFTTQGGHPGDMSVTENTVAIHLVSLSWFTPAPPAPAP
PRRRHSRYTEWRLHTIAYFKNLWDDVVVRKSR

Enzyme Prediction     

No EC number prediction in MGYG000004172_00458.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	19	96	2e-20	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	7.62e-21	1	154	81	215	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.48e-15	17	100	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.61e-06	1	156	45	195	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	8.96e-04	40	84	139	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AST53761.1	8.56e-58	1	232	1	218
ABR43046.1	8.56e-58	1	232	1	218
QCY56520.1	8.56e-58	1	232	1	218
QUT95190.1	8.56e-58	1	232	1	218
BBK91286.1	8.56e-58	1	232	1	218

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	9.17e-09	2	100	57	158	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
P38287	1.91e-06	1	160	61	203	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
P33300	2.58e-06	1	100	54	156	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
O14084	5.37e-06	2	100	64	168	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004172_00458.