CAZyme Information: MGYG000004172_01482

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae
• CAZyme ID: MGYG000004172_01482
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	MGYG000004172_5|CGC4	41449.38	8.3728

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004172	3050906	MAG	United Kingdom	Europe

• Gene Location: Start: 212362; End: 213450 Strand: +

Full Sequence      

MKRLIPALLLGILFPEPALTARNRQDADRALTDRVAKWQIEHFDTVSFPLGHWTNAALYR
GMAEWAARTNADFIYDFLREIGRKSDWDMPPRIYDADDLCVGQTYFELSEKYDDPRMIAK
VKDRVDYIMAHSQTGSLRLPNGKYNRNRWGWCDALFMAPPVYVQLYLKTGKRDYLDFCTS
EYKVTVDSLFDRNDNLFYRDLRLVNDRGKNGKKVFWGRGNGWVYAGLALMLQRIPKDDPV
YGYYLDLFLKMSPAVLRCQDKAGSWHSSLYAPEYYPQPENSASGFFVYGMAWGVNHGILG
KEYRKAAQKGWNALKSHVNGEGKLGYVQPIGHAPVEISGEMTAVYGVGAFLLAASEMMEM
NL

Enzyme Prediction     

No EC number prediction in MGYG000004172_01482.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	51	358	3.2e-83	0.9578313253012049

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.18e-89	33	360	3	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	6.78e-52	52	357	35	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY53945.1	1.03e-142	2	361	4	362
QQA08868.1	2.36e-133	2	361	3	360
AAO78027.1	2.36e-133	2	361	3	360
QMW85349.1	2.36e-133	2	361	3	360
ASM64975.1	1.11e-126	3	361	2	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	1.07e-63	34	361	35	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	5.60e-50	38	356	44	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.29e-45	53	356	39	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
3QWT_A	1.12e-13	151	324	167	338	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	9.82e-66	16	361	45	412	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	7.06e-63	34	361	42	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	3.63e-59	34	361	40	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000504	0.998520	0.000417	0.000200	0.000169	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004172_01482.