CAZyme Information: MGYG000004172_01488

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae
• CAZyme ID: MGYG000004172_01488
• CAZy Family: GH33
• CAZyme Description: Sialidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000004172_5|CGC5	42050.2	8.3334

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004172	3050906	MAG	United Kingdom	Europe

• Gene Location: Start: 217911; End: 219077 Strand: +

Full Sequence      

MLLPFLSLLLLTGTSAARGGSPAVSSPETIFQRQTEGYHTFRIPSLTVTADSTLLAFAEG
RRNSRSDTGDIDLVLRRSTDGGKSWGPLITVWDDGENVCGNPSAVVDRATGRIVLVTTWN
LGSDHEKEINARTSKDTRRVFVLFSDDDGINWSSPREITASVKDPAWTWYATGPCHAVQL
QKGKHKGRIVVPCDYGEFTGKGSVYHSLLIYSDDGGESWHTGARSPVGGNESTAAELSDG
SVMLNMRGVRGPERERNGSCRSVAVSRDGGVTFGPVRHDTVLIEPVCQGSLLNYAPKGKP
TRTLLFSNPASKSKRVDMTLRISRDNGRSWEQALKFDSRPAAYSDLTVLPGGDIGILYET
GEASPYERIVFRTVPASVITGKTKLSAQ

Enzyme Prediction     

No EC number prediction in MGYG000004172_01488.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	30	374	2.4e-98	0.9678362573099415

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	6.40e-111	28	375	1	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	4.72e-34	53	356	2	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13859	BNR_3	1.84e-15	43	247	1	193	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd00260	Sialidase	2.46e-09	37	347	11	323	sialidases/neuraminidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates as well as playing roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed beta-propeller fold. This hierarchy includes eubacterial, eukaryotic, and viral sialidases.
COG4409	NanH	2.99e-07	34	360	268	701	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBD46002.1	1.84e-128	23	374	33	370
AYQ36531.1	3.07e-125	30	372	29	363
ADG69260.1	8.34e-121	31	380	215	558
QDV28174.1	1.18e-120	27	380	207	558
QQL50302.1	2.14e-120	37	374	43	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EUR_A	1.73e-52	19	366	4	351	Sialidase[Micromonospora viridifaciens],1EUS_A Sialidase Complexed With 2-Deoxy-2,3-Dehydro-N- Acetylneuraminic Acid [Micromonospora viridifaciens]
1EUT_A	1.87e-50	19	366	4	351	Sialidase,Large 68kd Form, Complexed With Galactose [Micromonospora viridifaciens],1EUU_A Sialidase Or Neuraminidase, Large 68kd Form [Micromonospora viridifaciens]
1W8N_A	3.39e-50	36	366	16	347	Contributionof the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens. [Micromonospora viridifaciens],1W8O_A Contribution of the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens [Micromonospora viridifaciens]
1WCQ_A	1.25e-49	36	366	16	347	Mutagenesisof the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_B Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_C Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens]
2BZD_A	2.41e-49	36	366	16	347	Galactoserecognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_B Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_C Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02834	1.83e-50	1	366	19	393	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P31206	1.24e-39	41	363	203	530	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
A6BMK7	3.20e-39	33	369	69	404	Sialidase-1 OS=Bos taurus OX=9913 GN=NEU1 PE=2 SV=2
O35657	7.69e-39	33	361	63	390	Sialidase-1 OS=Mus musculus OX=10090 GN=Neu1 PE=1 SV=1
Q99PW3	3.98e-38	33	361	63	390	Sialidase-1 OS=Rattus norvegicus OX=10116 GN=Neu1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000394	0.998977	0.000163	0.000171	0.000143	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004172_01488.