CAZyme Information: MGYG000004172_01502

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae
• CAZyme ID: MGYG000004172_01502
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645	MGYG000004172_5|CGC6	73127.68	8.2442

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004172	3050906	MAG	United Kingdom	Europe

• Gene Location: Start: 246160; End: 248097 Strand: +

Full Sequence      

MTLTRHLMIVLGCLCALRATASDQGEKVAPTVMPAVSYFTHGTVRLNEGPLLDLQRQGER
YLLRLQPDSLLHFVRTEAGLAPKARPYGGWESCDVWGAGPLRGGFVGYYLSGLALMYRTT
GNPLLLERLRYTLAELDTCRRAGGDGYIMGIRNGRALFRDVAAGKIKTDNPTVNGSWAPL
YLIDKTMRGLAIAYVTCGEERALTLLTGLADWFGREVIDRLDDDQLQRLLICEHGSINLS
YVETYALTGDKRYLEWGRRLHDRAMWEPLSQNRDILLGWHANTQIPKFIGFERYYAFTGD
ERFDRAARAFWEIVTGRHSWVIGGNSAGEFFFPVGEFEKKMLSGGGPETCNSANMMRLTE
ALFAYTPTARMADFYERVLLNHILPAYDPQRGMCCYFTPMRPAHYRIYGSEEGSFWCCNQ
SGLETPAKLTRFVFTRQGDDPMVNLFVPATLEWKERGMRLEQQASMPESGRVVLRFRPGD
SRDVRLLVRRPGWGEKAAIRVNGRTVTPTVGRNGYWEIETRWKKENTIEIDFPLQLRTEP
LPGSDRYAALLYGPYVLAGRMGTENLPASFWAGIDNIAHNKIPVPDRSVLPAGEPPLRHI
VRRSERPLTFGIDAPGYGQVSIEPFYRIHFERYTLYWPLGTAPEE

Enzyme Prediction     

No EC number prediction in MGYG000004172_01502.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	44	558	8e-169	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	44	558	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	8.45e-102	33	626	1	571	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	1.30e-11	562	637	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.
COG4225	YesR	0.003	186	268	41	115	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW85339.1	4.65e-262	20	640	29	654
QQA08878.1	4.65e-262	20	640	29	654
AAO78017.1	4.65e-262	20	640	29	654
QUU06683.1	7.60e-261	37	639	44	653
QQT79801.1	7.13e-259	37	639	44	653

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	9.12e-133	36	636	25	647	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	5.47e-127	36	636	25	647	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
5MQO_A	4.76e-19	225	577	234	622	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	1.32e-14	191	534	151	532	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	7.01e-14	191	533	151	531	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000356	0.997960	0.001041	0.000217	0.000218	0.000177

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004172_01502.