CAZyme Information: MGYG000004172_01585

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae
• CAZyme ID: MGYG000004172_01585
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354		40030.74	10.0438

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004172	3050906	MAG	United Kingdom	Europe

• Gene Location: Start: 19187; End: 20251 Strand: +

Full Sequence      

MENEIPKHLLVIRLSAMGDVAICVPVIAALKRDNPTLKITVLTRDFFRPFFREIEGIEFV
SPDLKGRHRGLSGMFRLWKELRKKEFTHVADLHDVLRTKFLRRLLSLSGCRVEVIDKGRS
EKRMLTRKFRKIMEQLPTSMQRYGETIARLGFSFSEPVPAVRKPLPVPSSIGRRSGTKQG
KWIGVAPFAQHKGKIYPTLLTDELIGLLVSRFERVFLFGGGPYERDFAECMEVRHGERVI
SVIGRVSLSEEMDIMSNLDAIVTMDSASMHIASLMGVPVVSVWGATHPYAGFYGFGQDPR
NAVQLDLPCRPCSVYGNKRCLFKDYRCLQGIAPQTIFDRVCSVTDTPPPSDRNS

Enzyme Prediction     

No EC number prediction in MGYG000004172_01585.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	75	323	4e-34	0.9644444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.53e-53	8	341	1	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	7.25e-41	6	338	1	324	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	5.05e-16	74	325	1	246	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	9.65e-13	6	286	5	291	lipopolysaccharide core biosynthesis protein; Provisional
PRK10916	PRK10916	3.54e-04	208	288	209	292	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCG54381.1	1.67e-120	6	347	9	349
QGA24759.1	3.96e-119	17	341	1	323
ALO49713.1	4.90e-98	7	346	4	349
ASU33781.1	3.05e-97	6	336	4	334
AGB28723.1	8.44e-97	7	340	20	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	4.51e-06	7	294	9	296	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45042	1.85e-07	8	288	2	292	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
Q9R9D5	3.23e-06	18	286	5	279	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004172_01585.