CAZyme Information: MGYG000004172_01790

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae
• CAZyme ID: MGYG000004172_01790
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	MGYG000004172_7|CGC1	44651.96	8.399

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004172	3050906	MAG	United Kingdom	Europe

• Gene Location: Start: 14548; End: 15723 Strand: +

Full Sequence      

MKIFRNRFRTGVATLAALGAGLCAQAQIEPRSWVDSVARYGMERFLPADEYKWDWGQATL
LNSVVHLYREAAPDRRKPYLDYVRTAMDRTLPVANGKHPNAVASAHGMAFLAGVLKDPVY
KEKTKAIYTDYLLAPRASNGGVSHRAETVEFWDDTIYMLGMFFFELYRQTGDERYIEAFM
EQYYAHQQKLSDPKTGLWVHGWDADDEDYDDRCSQPGWPDRTTRRSHEVWGRGNGWIVMA
LADGLNTVPRNSRHWKEMAGELKRMVAVLPSLQDGETGMWYQLPLRAGEEGNFLESSCTA
MFGYGMVLGMKYGVLKKKTYKPVVDRIYEGLRRHAMVREGGAYLAPDRVCLGTCIGDKEY
YFKRKVGQGVNYAIGAYVMFGLEYEKFCGLR

Enzyme Prediction     

No EC number prediction in MGYG000004172_01790.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	386	7.8e-77	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	5.76e-58	33	387	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.42e-50	53	386	34	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACU05080.1	3.95e-152	24	391	24	391
AWL08075.1	1.23e-145	24	386	14	376
SCM55422.1	2.27e-115	33	386	615	965
QUT90052.1	4.14e-109	5	386	2	379
ALJ58834.1	2.35e-108	5	386	2	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	7.49e-35	40	385	28	365	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.19e-34	40	385	18	355	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	1.00e-29	53	385	23	359	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3QWT_A	5.44e-21	53	361	65	354	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	8.01e-18	53	327	66	333	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	4.10e-34	40	385	28	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	3.30e-13	170	325	13	157	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.30e-13	170	325	13	157	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
L7P9J4	6.03e-10	98	386	102	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.040625	0.795437	0.152434	0.009718	0.001057	0.000697

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004172_01790.