CAZyme Information: MGYG000004174_00682

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-11
• CAZyme ID: MGYG000004174_00682
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	MGYG000004174_14|CGC1	41915	6.8113

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004174	2366989	MAG	United Kingdom	Europe

• Gene Location: Start: 30939; End: 32030 Strand: -

Full Sequence      

MDVKAYIDGFLARYKPYKPYWNYEDGCVLIGCVHLFQATKDTRYRDFVLDYLSQRVMPDG
DIPTYERGQYNIDSINTGKTLFFALDQTGDERYRKAIEWHMERLRQHPRCQCGNYWHKSI
YPNQIWLDGLYMAQPFVMAYEMRFGGMRKVADIVMQFQNVRKFLFDEAKGLCYHAYDEAR
VQPWANKQTGCSPNFWLRSMGWYLMALVDCMDGMNEQLFEHYKALEAIFREAIRGILRYQ
DPKTGLFYQVIDRADVAGNYLETSGSAMIAYALMKGERMGALLQGRYAALGAKAFDSLVS
DKLYADEDGVVRLHDICLVAGLGPGEKRDGSVAYYLSEPRACDDSKGVGPFMMAYAQRLR
MGE

Enzyme Prediction     

No EC number prediction in MGYG000004174_00682.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	15	359	2.5e-102	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.39e-90	2	360	15	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	9.85e-74	21	361	27	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
cd04743	NPD_PKS	1.77e-04	240	328	7	97	2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS). NPD is part of the nitroalkaneoxidizing enzyme family, that catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites. NDPs are members of the NAD(P)H-dependent flavin oxidoreductase family that reduce a range of alternative electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ62178.1	1.33e-154	4	361	9	365
BCJ93648.1	2.37e-142	3	363	6	366
BCJ96410.1	5.24e-134	3	359	10	362
CBL00657.1	5.37e-125	15	359	37	378
AXB29657.1	7.61e-125	15	359	37	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	6.74e-99	4	354	6	354	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	4.68e-70	7	357	25	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.97e-69	7	357	15	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.56e-69	7	357	25	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	4.88e-46	132	359	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	4.88e-46	132	359	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004174_00682.