CAZyme Information: MGYG000004174_00899

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-11
• CAZyme ID: MGYG000004174_00899
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	MGYG000004174_21|CGC1	39216.43	5.4994

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004174	2366989	MAG	United Kingdom	Europe

• Gene Location: Start: 18788; End: 19846 Strand: -

Full Sequence      

MKDALALAGRVLEKLTATHAGGGENDHLTLDTWEWPQGVAVYAMLKLWRATGDSAVLGQV
RDWYEGHIARGLPPRNVNTTAPMLGLTVLYEHTRDARYRSLIEDWALWVINGMPRTQEGG
LQHITSDDVNTTHDENPQQLWDDTLYMTVLFLLRAGLALERPEWVAEAEYQLTLHIKYLH
CPHNGLWYHGWTFEGRHHFGGAFWARGNAWITAGAPEFLEWMPQGAARRLLMETWREQCA
ALLPLQDAQTGLWHTLLDHADSYVETSASAAIAYGLLKGARLGWLGEDAARAGLRAAEGV
AAQIGPDGWVANVSYGTPMGMDLDFYRGIPLRPTAYGQGLAFLMFTELIGAQ

Enzyme Prediction     

No EC number prediction in MGYG000004174_00899.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	27	348	3.5e-96	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.36e-94	29	347	30	348	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.76e-87	33	349	27	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUH33530.1	9.95e-110	22	349	34	356
QPC88026.1	2.42e-106	22	347	44	363
QFU08292.1	1.09e-105	22	347	34	353
AGI39070.1	4.65e-105	1	347	1	341
ANW98431.1	4.65e-105	1	347	1	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	3.02e-88	33	349	65	377	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.23e-85	33	349	66	378	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	4.87e-82	33	347	47	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	2.28e-19	33	348	39	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.68e-19	33	348	29	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.76e-45	33	349	29	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	1.25e-18	33	348	39	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.14e-10	147	296	1	158	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.14e-10	147	296	1	158	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004174_00899.