CAZyme Information: MGYG000004176_02057

Basic Information

• Species: Pradoshia sp001183965
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-1321; Pradoshia; Pradoshia sp001183965
• CAZyme ID: MGYG000004176_02057
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359		42015.93	6.0192

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004176	2444221	MAG	United Kingdom	Europe

• Gene Location: Start: 564; End: 1643 Strand: -

Full Sequence      

MSSISLVMIVKNEERVLGRCLDSICDLVDEIVIVDTGSEDRTVEIAREYTKHIYSYEWTN
DFAAARNFAFQKAGKEYTMWLDADDIIFPEDREKFLHIKESLSHKPDSVLMPYVLGRDSY
GQITSSLKRNRLVKTSRGFQWKGAVHEYLEVHGTIIEADICITHLSVKSKKTDRNLKIYE
QLEQQQKQLSPRDLYYFGNECFEHGLLEKCLKLYREFLDTNAGWQEDCIAAIDRAAEALL
QLGRTEEAEELLFESFKYDIPRANISCKLGYIYFSKSLYHRAIYWYKAAAECDLERVKET
GALVNYAYYTWLPHIQLCVCYDKIGKKELAYCHNEMARFYNPTNNLVLQNKQYFEKIIT

Enzyme Prediction     

No EC number prediction in MGYG000004176_02057.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	128	7.2e-22	0.7647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	2.34e-50	4	230	2	229	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
pfam00535	Glycos_transf_2	1.32e-20	5	140	1	138	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.11e-18	7	97	2	100	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
TIGR04195	S_glycosyl_SunS	4.40e-18	3	219	58	290	peptide S-glycosyltransferase, SunS family. Members of this family include SunS, the S-glycosyltransferase that transfers a sugar (substrate is variable in reconstitution assays) onto the precursor of the glycopeptide sublancin, which once was thought to be a lantibiotic.
COG0463	WcaA	5.05e-15	1	91	2	100	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKO91415.1	1.24e-137	1	356	1	356
AFM39682.1	2.27e-127	3	358	7	360
ANB62059.1	2.46e-127	1	359	1	358
AFQ42404.1	3.42e-126	3	357	7	359
AET66053.1	1.21e-125	3	358	7	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MSK_A	8.31e-17	3	254	67	331	ChainA, Glyco_trans_2-like domain-containing protein [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1],7MSK_B Chain B, Glyco_trans_2-like domain-containing protein [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1]
7MSP_A	8.24e-14	3	221	55	288	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSP_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]
7MSN_A	1.28e-13	3	221	55	288	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSN_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42460	5.36e-16	1	150	7	151	TPR repeat-containing protein Synpcc7942_0270 OS=Synechococcus elongatus (strain PCC 7942 / FACHB-805) OX=1140 GN=Synpcc7942_0270 PE=4 SV=1
P44029	2.58e-15	1	96	1	96	Uncharacterized glycosyltransferase HI_0653 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0653 PE=3 SV=1
O31986	7.02e-13	3	221	55	288	SPbeta prophage-derived glycosyltransferase SunS OS=Bacillus subtilis (strain 168) OX=224308 GN=sunS PE=1 SV=1
O64036	7.02e-13	3	221	55	288	Glycosyltransferase SunS OS=Bacillus phage SPbeta OX=66797 GN=sunS PE=3 SV=1
Q54435	7.29e-10	3	107	6	105	Lipopolysaccharide core biosynthesis glycosyltransferase KdtX OS=Serratia marcescens OX=615 GN=kdtX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004176_02057.