CAZyme Information: MGYG000004177_00069

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660
• CAZyme ID: MGYG000004177_00069
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		43475.65	6.9045

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004177	993933	MAG	United Kingdom	Europe

• Gene Location: Start: 55479; End: 56567 Strand: -

Full Sequence      

MKKNKFKICVYAITKNEEKFANRWYESMKEADEIYVLDTGSDDKTVEILKNLGVKVKIKE
IKPWRFDVARNESLNLVPKDADICVCTDLDEVFEKGWRKKLENKWSDDTNRIYYNYNWSF
YENGEPAVNFYISKIHDRKNYIWKHPVHEVLNTNLSKENILTLDEITLNHYPDPTKSRSS
YLGLLELSVEEEPFDDRNMHYLGREYMFHGEWNKCIDTLIRHLNLKNAVWKPERAASMRF
IGRSYKALKRYKEAEMWFKEAIKETPNLREPYMELAMLKYEQKDWEEVEKYINKVLEIKQ
HDKIYINEPNCYNETPYDLLSLSYFYQGKISESLEAIKKAIAINNKDERLKNNLKIIEEN
MK

Enzyme Prediction     

No EC number prediction in MGYG000004177_00069.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	7.19e-13	7	172	1	165	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
sd00006	TPR	5.71e-10	235	342	1	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	7.66e-10	199	297	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
pfam00535	Glycos_transf_2	1.95e-07	9	147	1	151	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
TIGR02917	PEP_TPR_lipo	4.61e-06	201	348	95	227	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS58818.1	8.31e-128	4	357	2	356
ACV63878.1	4.60e-122	4	357	2	355
QOX65321.1	6.52e-122	6	361	4	360
QHQ60865.1	4.16e-119	4	361	2	360
AQS58819.1	1.54e-118	5	357	3	356

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004177_00069.