CAZyme Information: MGYG000004180_01660

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000004180_01660
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MGYG000004180_13|CGC3	45555.37	5.4401

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004180	4626686	MAG	United Kingdom	Europe

• Gene Location: Start: 52566; End: 53753 Strand: -

Full Sequence      

MSNKYIFSTLFACFLLQGNLQNIQAQDYPASPLEKEGYRLIFHDEFEGKEIDRAKWIPEY
LPSWPKDRTVCTPTYEMKDGVIRLTIDRDSKNEFDKGMYISGFMSASRTGMHHYDPERKA
LHRIKTEATQINQYGYYEMRAKMQAGGGVHCAWWLIGFEDDPNQSCEIDIFEILGTDVDR
IWSTVHSWKDSTIRYHTEHPWFANKKLADEFHVYGFDWTPEGVTVYVDGIQVMTHKAAIT
YPLIQIISFYDNRKAKNGWTGTYDPSVPYPKSFDIDYIRMYKKIPDSCQAVPENELRITA
IEPARLQVSEGKATLRDIDGHVTRELLYTPSFVNVHYNDGTVTQQFVEWEPLSDTAFRRI
QDAGTVIVNGKITGLSDDLLKGQEATLIITTTKND

Enzyme Prediction     

No EC number prediction in MGYG000004180_01660.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	43	281	1e-61	0.995850622406639

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00413	Glyco_hydrolase_16	6.15e-52	44	281	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08023	GH16_laminarinase_like	1.09e-35	42	281	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02178	GH16_beta_agarase	3.09e-18	44	282	27	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
pfam00722	Glyco_hydro_16	2.93e-16	133	279	32	168	Glycosyl hydrolases family 16.
cd02179	GH16_beta_GRP	4.90e-12	40	232	1	223	beta-1,3-glucan recognition protein, member of glycosyl hydrolase family 16. Beta-GRP (beta-1,3-glucan recognition protein) is one of several pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. They are present in insects and lack all catalytic residues. This subgroup also contains related proteins of unknown function that still contain the active site. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50278.1	3.35e-290	1	395	1	395
AWS25493.1	1.43e-105	22	387	242	603
ASY50995.1	1.43e-105	22	387	242	603
QCJ40812.1	2.61e-79	29	381	114	494
AIF44579.1	7.68e-77	29	370	111	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UPS_A	5.11e-36	24	284	16	280	GlcNAc[alpha]1-4Galreleasing endo-[beta]-galactosidase from Clostridium perfringens [Clostridium perfringens],1UPS_B GlcNAc[alpha]1-4Gal releasing endo-[beta]-galactosidase from Clostridium perfringens [Clostridium perfringens]
5WUT_A	9.09e-19	36	282	3	235	Crystalstructure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.],5WUT_B Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.]
2VY0_A	1.83e-15	33	281	8	259	TheX-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]
6XOF_A	2.79e-12	38	283	24	268	ChainA, GH16 family protein [uncultured bacterium]
6XQF_A	1.24e-11	38	283	24	268	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23903	5.58e-09	37	283	422	681	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
O33680	1.81e-08	124	281	308	457	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1
Q84C00	5.20e-08	134	281	103	243	Beta-glucanase OS=Acetivibrio thermocellus OX=1515 GN=licB PE=1 SV=1
A3DBX3	2.93e-07	134	281	103	243	Beta-glucanase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=licB PE=1 SV=1
Q9Z3Q2	1.69e-06	52	276	257	460	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000413	0.997468	0.001532	0.000201	0.000188	0.000171

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004180_01660.