CAZyme Information: MGYG000004182_01909

Basic Information

• Species: Phocaeicola sp900551445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900551445
• CAZyme ID: MGYG000004182_01909
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512	MGYG000004182_48|CGC1	57162.63	6.5803

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004182	3344512	MAG	United Kingdom	Europe

• Gene Location: Start: 1949; End: 3487 Strand: +

Full Sequence      

MKKQTLFLFLCGLCLWMNTATALEYNVLRHGVVGDGKTLNTDSLQAAIDALHASGGGQLY
FPAGRYLTGSLQLKSNVVLYLEKEAVLLGSTSPYDYPGFSTEKELKVNDDHFDQALIYAE
GAEHIGIRGEGCIDGQGRELALTIDSLHHTGELVDKHYNTYRKRPNTRPKLLFIRGCRNV
EICNARLRSSAAWGLSFSLCTDLTLDSLHVENRAYWNNDGIDISDCKRVRISNCYINSAD
DGICLKSHNRGAWNDGVSISNCHIISSASAIKFGTESLGGFKHVKIDSIWVKDTYRSAIA
IESVDGAEIEHVQVSNVHAVNTGNAIFIRLGHRSGDQPGYLRHVSIKNVYVEVPFGRPDL
NYDLRGPSVTFFHNPFPSSISGIPGHDIEDVTLENIEIVYPGRATRGMAYMSLSRLKDVP
ENEKGYPEFTMFEELPSWGFYVRHVKGIQLRHIKLRLQEDDFRPAFVFDRVSDIHLTGID
LPENKQAGQVVLRKCTLQEVDATAKNQLQEVD

Enzyme Prediction     

No EC number prediction in MGYG000004182_01909.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	52	404	4.7e-60	0.9261538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	1.18e-61	19	485	77	519	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	8.44e-12	167	328	83	246	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN03010	PLN03010	4.45e-09	25	328	47	316	polygalacturonase
pfam12708	Pectate_lyase_3	1.03e-08	26	80	3	59	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
PLN03003	PLN03003	1.29e-07	26	274	25	244	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37829.1	5.67e-284	1	498	1	498
QDW21015.1	1.45e-197	1	502	1	490
SOE23384.1	4.74e-197	24	493	31	504
QGK73231.1	8.29e-197	5	502	8	490
AWK06672.1	2.36e-196	3	504	2	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MXN_A	3.80e-31	24	239	21	217	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]
5OLP_A	2.34e-26	24	284	44	320	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
3JUR_A	7.76e-22	24	349	27	381	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
2UVE_A	1.91e-16	26	243	158	405	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
4C2L_A	1.79e-07	36	278	24	248	Crystalstructure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	9.32e-23	22	398	50	402	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P15922	2.41e-15	19	243	146	398	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
Q9ZFG9	2.72e-09	23	79	1	65	Alginate lyase 7 OS=Azotobacter vinelandii OX=354 GN=algE7 PE=1 SV=1
Q44494	8.55e-08	23	77	1	63	Mannuronan C5-epimerase AlgE1 OS=Azotobacter vinelandii OX=354 GN=algE1 PE=1 SV=1
Q44496	8.94e-08	23	79	1	65	Mannuronan C5-epimerase AlgE3 OS=Azotobacter vinelandii OX=354 GN=algE3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000243	0.998950	0.000245	0.000175	0.000171	0.000162

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004182_01909.