CAZyme Information: MGYG000004182_01994

Basic Information

• Species: Phocaeicola sp900551445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900551445
• CAZyme ID: MGYG000004182_01994
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569	MGYG000004182_52|CGC1	63564.77	6.5419

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004182	3344512	MAG	United Kingdom	Europe

• Gene Location: Start: 13077; End: 14786 Strand: +

Full Sequence      

MKHFGKMILGACTVLTLTCSPAQMLAQSLSPSTQWEWNKGTIVIKTPERPAGQECVLGLT
VPKMNVVRVGFVGLGMRGPGAVERFTHIAGTKIVALCDYEKDRAERCQGYLQKACLPEAA
IYSGAEGYKALCERDDIDLVYIAADWDHHFPIAKYAMEHGKNVAIEVPSAMNLEQCWELI
NLSETTRKHCMILENCCYDWFEMNTLNMAQQGVFGEVIRAQGAYIHNLDDFWPYYWKNGK
EDKLGWRLRYNKENRGDVYATHGLGPVAQALDIHRGDRMTTLVAMDTKSVHGKALVEKAT
GEPCEEFRNGDHTTTLIRTANGKVIEIQHDVMNPQPYNRLYQLTGTKGFANKYPIEGYAV
DAAQMKASGVQPKVDNLSSHSFLPEKEMQALVDKYQHPILKKYGEMAKEVGGHGGMDFIM
DSRLVYCLQNGLPLDMDVYDLAEWCSLAELGAISMDNGCAAVAFPDFTRGHWNDVKGFHH
AFATPEEEAATELTAETATLSLKAQGMKEWLAKSKKADVKKEEVEAHIQQLSAQLETVQK
KANGTESKELKEAVKQAEKMLKQAQKLLK

Enzyme Prediction     

No EC number prediction in MGYG000004182_01994.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	63	473	9.4e-158	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	3.80e-21	64	361	1	268	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	8.42e-11	67	192	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	3.39e-08	67	217	5	145	putative oxidoreductase; Provisional
PRK10206	PRK10206	4.57e-04	136	262	64	212	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24012.1	0.0	1	512	1	513
QCQ31109.1	0.0	5	510	6	511
ALK83890.1	1.11e-309	1	516	1	517
QJR75586.1	1.15e-309	1	516	1	517
AND19749.1	1.15e-309	1	516	1	517

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	7.28e-84	49	472	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	5.72e-67	67	476	21	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E82_A	1.47e-07	65	273	6	191	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
3EVN_A	3.87e-06	64	229	3	161	CRYSTALSTRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6L1Z2	1.28e-309	1	516	1	517	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	2.59e-301	7	516	8	516	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6KYY1	3.71e-245	6	503	5	498	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
A6KX96	2.22e-210	44	483	38	470	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
P0C863	3.47e-210	2	483	3	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000419	0.558300	0.440605	0.000256	0.000220	0.000182

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004182_01994.