CAZyme Information: MGYG000004183_00287

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; CAAEEV01
• CAZyme ID: MGYG000004183_00287
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329	MGYG000004183_4|CGC1	36562.5	5.3937

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004183	2339424	MAG	United Kingdom	Europe

• Gene Location: Start: 3; End: 992 Strand: +

Full Sequence      

MRRGWLDHEGKRYRLDRDDGHLWTGDLFAEGSWYHADADGALVMGWLTGSSGSRFYYDPA
RGGALAIGWFDADGRRYFAGDDGAMRRGWLDHEGKRYRLDRDDGHLWTGWYTVDGKWYYS
NDEGVLMTGWVLDGAYYHYYGKGETFFPYKSQELYYVSGSRYASADSLIAAFKASGARYP
AAELARGGAGSVEEFCRIVYEESVAEGIRPQVVFCQAMLETGWLRFGGDVSIGQFNFAGL
GAVGSGAAGASFPDVRTGIRAQVQHLKAYANNEALNNACVDPRFSYVTRGVSEYVQWLGI
PNNPTGKGWAATDGYGMNIASMIDQYGLW

Enzyme Prediction     

No EC number prediction in MGYG000004183_00287.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	198	328	2.3e-21	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033838	PspC_subgroup_1	2.52e-29	1	160	504	662	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	4.11e-27	1	159	481	638	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
411490	NF033930	3.57e-23	4	138	444	574	pneumo_PspA pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	6.92e-22	1	144	524	681	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033840	PspC_relate_1	5.20e-21	4	144	511	645	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW77434.1	5.62e-62	151	325	916	1090
QIB58002.1	5.62e-62	151	325	916	1090
QBE99413.1	5.03e-61	151	325	916	1090
CBL19417.1	2.04e-60	155	325	55	225
QCU04040.1	8.12e-60	155	323	55	223

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	2.36e-17	192	323	68	192	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998681	0.001194	0.000115	0.000003	0.000001	0.000021

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004183_00287.