CAZyme Information: MGYG000004183_01696

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; CAAEEV01
• CAZyme ID: MGYG000004183_01696
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
251		28381.26	9.6568

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004183	2339424	MAG	United Kingdom	Europe

• Gene Location: Start: 15; End: 770 Strand: +

Full Sequence      

MWFLREAKFLNQARLTLNTSCAVSGTGFFIDADVLKQAGGWKWHLLTEDIEFSASSIIDG
IRISYTPTAMLYDEQPTTFIDSWNQRFRWAKGFYQVFFHYAKGLARGVVKNPKGYRFACY
DMLVTLAPGMLLTIISVVFNAAIIILATTGAMTVGVAIASSISSIFFCLFNFFMFMFVFG
VLTTFVEWDSIRTTTAKKIKYMFTFPFFQFTYIPIALVALVKKATWKPIKHSISVDVAEF
SEAASSKKELS

Enzyme Prediction     

No EC number prediction in MGYG000004183_01696.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	1.18e-14	1	218	192	401	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06438	EpsO_like	6.01e-12	1	52	133	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
PRK11204	PRK11204	9.56e-10	16	106	205	292	N-glycosyltransferase; Provisional
pfam13641	Glyco_tranf_2_3	9.31e-09	2	92	144	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
pfam13632	Glyco_trans_2_3	6.98e-08	25	145	74	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAN76823.1	1.95e-141	1	243	192	434
BCA88856.1	5.55e-141	1	243	192	434
BCS57026.1	6.41e-140	1	243	192	434
BAK44311.1	3.98e-136	1	247	189	435
QOS69441.1	1.72e-135	1	245	189	433

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000011	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
125	147
160	182
202	221