CAZyme Information: MGYG000004185_02339

Basic Information

• Species: Bacteroides sp900553815
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900553815
• CAZyme ID: MGYG000004185_02339
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418		48085.95	9.5969

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004185	3289740	MAG	United Kingdom	Europe

• Gene Location: Start: 14922; End: 16178 Strand: -

Full Sequence      

MKRFKKEIAAYIERVGAQKGIDIGIGNILFFKRKLTDIGMKLKEGNISIKSLQIRPNLLT
CLYKEKKVAITCKDIVIDCHSFSKEPFQISNISFNIIYDVSNKNIRVDATLYNGVVCHFN
TSRQEDGRAFGLKIEDISIDHYKILFNSHISSTFLQSIQSDSILSFTLFFNHSNKVLYPQ
IQTSFNCHSLKISSTNYTLSKNYLLSQLKTRKHLGKYYIRYEHISKQICQMVICTEDPSF
HIHKGICPVQMGITLREAINQKKLGRGGSTISMQLIKNALLNNERTINRKLEEAILTLLM
ENYYHINKNDIIELYLNMIELAPDVYGIEDGARFYFNKPANQLAISEIITLTYIIPRPKH
FYEALLLKTEQLQHNLGRHITNYGGIALRKGIISSQEEINNDCIIFSKRFGVLPLIKE

Enzyme Prediction     

No EC number prediction in MGYG000004185_02339.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	215	364	1.2e-41	0.8305084745762712

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.75e-42	204	361	4	156	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	1.48e-39	190	358	52	217	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	3.88e-35	217	362	3	146	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK00056	mtgA	4.07e-30	221	361	65	203	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
COG5009	MrcA	3.64e-29	216	359	67	205	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM57796.1	1.02e-104	12	415	12	418
AXY74568.1	1.29e-43	218	400	428	612
QNN43964.1	1.51e-43	218	415	418	616
VTR36692.1	5.02e-39	44	409	195	567
ASZ11873.1	1.92e-35	215	415	406	607

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.31e-21	216	361	20	163	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.31e-21	216	361	20	163	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
3UDF_A	3.48e-19	219	361	42	182	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
5U2G_A	1.20e-18	224	376	48	198	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
7U4H_A	7.10e-18	219	372	43	192	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0AIQ0	2.80e-27	218	363	77	219	Biosynthetic peptidoglycan transglycosylase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=mtgA PE=3 SV=1
Q82U73	2.01e-21	204	363	63	219	Biosynthetic peptidoglycan transglycosylase OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=mtgA PE=3 SV=1
Q478U7	2.11e-21	205	361	51	205	Biosynthetic peptidoglycan transglycosylase OS=Dechloromonas aromatica (strain RCB) OX=159087 GN=mtgA PE=3 SV=1
C1D8R6	2.72e-21	218	376	61	222	Biosynthetic peptidoglycan transglycosylase OS=Laribacter hongkongensis (strain HLHK9) OX=557598 GN=mtgA PE=3 SV=1
Q7NS41	5.13e-21	205	376	48	222	Biosynthetic peptidoglycan transglycosylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004185_02339.