CAZyme Information: MGYG000004187_01054

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000004187_01054
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307	MGYG000004187_146|CGC1	33123.64	9.8281

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004187	2011841	MAG	United Kingdom	Europe

• Gene Location: Start: 1675; End: 2598 Strand: +

Full Sequence      

MIFSRQPRQCRKLPAEKFRISHFISASALAVTLGAAALWPDSDFASTAPSLARAQEDLVV
RSAIKPSDEALSGMAPSLTLLEGTAKTQAAAEETPEVLTVEDNAVHEGSPRHLVAEYISR
TFRIPMREARQITDWAVEIGEARDLDPLLILAVIGTESSFKPKARSHAGAEGLMQVMTSV
HEAKFDAFGGREAAFDPYANMVVGTDILSYLIQRTGSVRRALKWYSGAANLDNDRGYGAR
VMREHSLLAVAAEGRTDAAVKLHRAGKSAKSDVGNAARLGFARWVKLSGNAPRARNAGMQ
GERPKAS

Enzyme Prediction     

No EC number prediction in MGYG000004187_01054.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	143	244	2.2e-18	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	3.08e-19	147	244	1	98	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	5.53e-19	124	243	2	142	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.21e-15	125	243	3	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.26e-14	138	237	3	105	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16893	LT_MltC_MltE	2.46e-12	141	211	8	82	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF22549.1	8.15e-61	92	297	52	261
QDA55116.1	6.55e-59	114	289	102	280
QQS89286.1	5.52e-57	114	287	86	261
QTD43912.1	6.08e-38	84	256	66	242
QKO22158.1	1.93e-37	114	255	97	238

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27380	3.30e-09	135	248	7	122	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
O31976	5.94e-08	144	226	1434	1512	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	5.94e-08	144	226	1434	1512	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
C5BCE9	5.88e-07	127	246	186	324	Membrane-bound lytic murein transglycosylase C OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=mltC PE=3 SV=1
A7MLX9	5.98e-06	145	211	206	278	Membrane-bound lytic murein transglycosylase C OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.455111	0.536672	0.006277	0.001107	0.000391	0.000439

TMHMM  Annotations     

start	end
20	39