CAZyme Information: MGYG000004188_01359

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004188_01359
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
913	MGYG000004188_8|CGC1	105055.21	6.454

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004188	3351981	MAG	United Kingdom	Europe

• Gene Location: Start: 17998; End: 20739 Strand: +

Full Sequence      

MKKTILTLALLSCMQLTTAQQTSIDLSGIWRFQTDLMGFGKTPGSQLFLSKLPESILLPG
TTDEGGKGLANTARHVDRLTRKFEYCGQAWYQREVVIPESWKDKEITLFLERCHWETTVY
VDGKQAGIEEHLITPNRFTLTQQLTPGVHILTICVDNRLKYPMDQWNHGTSEYTQTNWNG
ITGRIELIAREKTYIHSLKPFPDIDHHSVQLDMELRNLTDSVSKGKLTLMLQDETGKQVS
RLETDVTLEKGSNRLEHVLQIGKDMKLWNEFNPYLYRVTATLSVGDRLDTLSTRFGMRQV
EQGEHHIRLNHRNIHLRGTLECCVFPLTGYPPTEVTEWKRIFRIVKEYGMNHVRFHSWCP
PKAAFEAADETGIYLQAELPMWIKDVGKYPERREFFEKEMIAMLDEYGNHPSFLLMCNGN
ENEGDFSVLEDLIQKGQKYDNRHLYSASTARTHTASDQYYTSHVTSKGWITVYDGKPSTD
WDRSKESDIDCPVIAHETGQRCMYPNFQEIKKYTGVLSPRNFEVFQERLARNGMLHQADD
FFHATGAHTILQYKEVNEALLRTPNSGGFQLLGLTDFPGQGSAFVGVLDAFWESKGLVTP
EKYRESCAPTVLLARIPKRTYLNNEAFTAQMEIYHYGENPLKRGQLEWYVEDEQGTTFKK
GRIATPAIQCATLDSLGLIRIELNGIEEARKMTLHTTLNGTYHNEWDFWVYPSTMTQPAT
DYLYATQYDNRVKEALERGKNVLLIPQKVNGRKAKFTGHFWNPIMFNWDPMIVGTLIQEE
HPCFNSFPTSSYADWQWWDVLNHATAMELEGMPSVTPVIQPIDTYEHNRKLGIAFEAQVG
KGCLFVLSVNCTEKTENLPAMRQLLYSVRNYVASPEFRPETRLEFYQLDQLFLTSEQKGK
ATNSEAVQQLLNK

Enzyme Prediction     

No EC number prediction in MGYG000004188_01359.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	17	495	2.6e-74	0.4933510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	4.69e-22	18	318	7	296	beta-D-glucuronidase; Provisional
COG3250	LacZ	2.38e-21	24	434	13	418	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.05e-14	91	421	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	1.81e-12	193	298	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	1.76e-07	85	167	63	155	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKA50946.1	0.0	16	913	23	923
CUA17504.1	0.0	18	913	29	923
CBW21485.1	0.0	6	913	19	923
ANQ59584.1	0.0	18	913	29	923
QUU05975.1	0.0	18	913	29	923

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5UJ6_A	1.08e-17	17	421	21	418	CrystalStructure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D8G_A	1.08e-17	19	421	31	426	D341AD367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]
6D50_A	1.43e-17	19	421	31	426	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
4YPJ_A	2.30e-17	87	421	70	410	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
3GM8_A	1.05e-10	87	424	66	399	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26257	3.10e-18	24	432	5	400	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
P05804	9.89e-09	26	318	15	292	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000658	0.947935	0.050541	0.000300	0.000283	0.000263

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004188_01359.