CAZyme Information: MGYG000004188_01847

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004188_01847
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1013		111851.8	8.8758

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004188	3351981	MAG	United Kingdom	Europe

• Gene Location: Start: 25339; End: 28380 Strand: +

Full Sequence      

MRSTTLKRIGLLVVLTLVFIARPVSDARTLPVPSAGVMEKSPIGALTEDARCRQWVDSVM
QTLTLRERIGQLFIYTIAPTQDKPNVDLLRKVVKDYKVGGLLFSAGTVPNQVALTNLAQE
WADVPLMITLDGEWGLSMRLKDTPRFPRNMVLGCIADDRLLYEYGREVARECREMGIHVN
FAPVADVNINPSNPVINNRSFGEDPANVARKVVAYARGLEDGGVLSVGKHFPGHGDTNVD
SHKALPTLRFTRQRLDSVELYPFRQMIGAGLNGMMVGHLAVPALEGKEGVPASLSRKVVH
DLLSEELQFKGLVFTDALAMKGVQGGGSVCLRALKAGNDLLLVPRRIKEEVEAVLQAVKR
GELSEADLSARCRKVLAYKYALGLKNRPFVRLSGLSTRLNTPEARDLVSRLSQASVTVLS
NKDRALPMDPTVKDVAVVHIGGGRADLTPLMQEMAIFVEPDKFDVGRDMDGAQKAALKKK
LAGYRRVVVCVTDEGWTDYQSLFAGWPEEVPLVYVLFIQGHRVKAGLRNCLAAASAVVLA
HSADEDVQRHAVNVLYGAAGADGRLSASIGSVFKAGCGVTLEARDLPRYNPDEHGMDARI
LKQIDDIVDEGLRKGAFPGCQVVVLKDGREMYNKAFGTFMGEGSQAVTTTDVYDLASMTK
TSATLLAVMKLYDQGLLSLTDYVSAYLPFLKGTDKERITVSDLLFHESGLPSTILFYQDA
IDKESYTGTLFRNRADAQHTVRIGRDTWANPRFSFRRGLTSVVRNDSCTLQVADNLWLAA
SFKQEMMRKIADSRLRDKRYRYSCVGFILLQQIVEARTGMPMDKFLEREFYRPMGLRHTG
FCPLRFLPKSGIVPSSVDGFLRKTTLQGFVHDESAAFLGGVSGNAGLFSNASEVARIGQM
LLNGGTLDGRRYLSEKTCRLFTTHTSRLSRRGLGFDKPETKEGRYSPCCASAPSSVYGHT
GFTGTCMWMDPDNGLVYVFLSNRICPNVWNNLLMELDIRERIQETIYRALLES

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	118	343	3.5e-59	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	5.43e-83	63	438	1	360	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.96e-82	64	376	1	314	Glycosyl hydrolase family 3 N terminal domain.
PRK03642	PRK03642	3.75e-65	586	1010	25	431	putative periplasmic esterase; Provisional
pfam00144	Beta-lactamase	1.17e-47	604	983	1	308	Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.
COG1680	AmpC	1.72e-42	591	983	28	363	CubicO group peptidase, beta-lactamase class C family [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBJ17996.1	0.0	6	1013	1	1012
QUT62072.1	0.0	6	1011	1	1010
QQA30538.1	0.0	6	1011	1	1010
QUT65080.1	0.0	6	1011	1	1010
QUU00608.1	0.0	6	1013	1	1012

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	8.62e-70	61	516	9	471	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	8.26e-57	47	430	24	449	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
4GYJ_A	4.17e-56	47	430	28	453	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3LK6_A	6.02e-56	57	430	10	423	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
3SQL_A	1.18e-50	60	409	12	373	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	4.52e-56	47	430	24	449	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	4.63e-46	89	440	55	434	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
O05213	1.92e-42	590	983	38	404	N-acetylmuramyl-L-alanine amidase OS=Bacillus subtilis (strain 168) OX=224308 GN=amiE PE=1 SV=3
B5R4I5	1.10e-40	590	1010	29	431	Putative D-alanyl-D-alanine carboxypeptidase OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=yfeW PE=3 SV=1
P77619	1.14e-40	586	983	25	395	Putative D-alanyl-D-alanine carboxypeptidase OS=Escherichia coli (strain K12) OX=83333 GN=yfeW PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000415	0.998877	0.000214	0.000164	0.000147	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004188_01847.