CAZyme Information: MGYG000004188_02557

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004188_02557
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		42785.74	6.1381

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004188	3351981	MAG	United Kingdom	Europe

• Gene Location: Start: 331; End: 1461 Strand: +

Full Sequence      

MIKTAFIGLGYRGRQLYGLLQHIRGFRIVAFADPGVEEDAVAGIPCYQRGEEDYRRMLAE
QKPQLVFVASPWHCHVRHALHCMECGADVALEIKGGLYIDEYRPLIACAARTGRRIYPLE
NTLFMRENLAIYNMVQAGLLGEIVYMRGGYRHDLRRLLLDDDGTLGNREKTESVWRSRFY
QEENGDLYPTHGLAPLCLFAGIGRTDRIKCLTSFASKPAGLRQRIKDLGGDSSVKIALGD
VVVTQLETENGVLLTLTHDTTLPRPRSLDFEVQGTKGIWQGDRRLIYVEGSSPEETWEPD
ESYINRYEHRYWRQWGQEAVEVDAHHGGMDYVMLKALEEDIRGGEPYPVTVDDLALWTSV
TPWSKVSIAERKTVFM

Enzyme Prediction     

No EC number prediction in MGYG000004188_02557.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	373	4.8e-112	0.9473684210526315

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	6.49e-20	1	353	3	317	Predicted dehydrogenase [General function prediction only].
PRK10206	PRK10206	0.002	1	144	1	146	putative oxidoreductase; Provisional
COG1086	FlaA1	0.010	1	71	116	186	NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC [Cell wall/membrane/envelope biogenesis, Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV42950.1	2.12e-212	1	374	9	382
QUT33801.1	1.14e-210	2	374	4	376
QQA30653.1	1.14e-210	2	374	4	376
QUT62197.1	1.14e-210	2	374	4	376
QRO24037.1	1.47e-166	2	376	4	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	2.11e-84	2	374	21	420	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.24e-44	2	370	43	423	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	1.15e-83	2	374	21	420	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	4.17e-73	2	369	34	425	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8G1	1.83e-71	1	374	52	448	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	9.58e-71	2	369	50	441	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4FN60	3.24e-56	2	359	61	420	Glycosyl hydrolase family 109 protein OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=SACE_6314 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004188_02557.