CAZyme Information: MGYG000004191_00769

Basic Information

• Species: CAG-269 sp001916005
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269; CAG-269 sp001916005
• CAZyme ID: MGYG000004191_00769
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423		49449.62	7.0847

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004191	1481282	MAG	United Kingdom	Europe

• Gene Location: Start: 43410; End: 44681 Strand: +

Full Sequence      

MEYMYILREALVWVITIFWLYQIGISLCSLVKLKEKPLKVKKDHKFMAIIPAHNEEAVVG
NLIESLKNQTYNKELYDIYVIADNCTDNTARIARDAGAIVYERFDETKKTKGYALDWFLQ
QKIEENADYDALFIFDADNIVDKDFIKNMNKHLCQGEDVVQGYRDIKNPTDNWITSGYAL
FYWTMHRFYHLARYNLGLSPMLNGTGFMVKFDIIKEMGGWKTVTLTEDIEFSLQRIIKGK
KLGWATDAIVYDEQPTGFKQSWSQRSRWTVGHMQCMKEYTNKLAEAAKDRKTMLNFDGFL
YIIGSIPMFILTIVLLLSNVLIYFGDGMTQMELFINILKYLVPTFVLPSLTAAFVMYLDG
KPIKPMIKGFFTYPLFMGSWIAINFKCLFKRETSWEKIEHKRSIKITDMNEENQEEEKIV
EKV

Enzyme Prediction     

No EC number prediction in MGYG000004191_00769.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	46	271	1e-26	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	2.35e-88	49	231	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	4.16e-52	49	228	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	3.40e-47	1	399	7	380	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	6.61e-22	46	268	4	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06421	CESA_CelA_like	8.15e-22	45	274	2	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDZ24461.1	1.72e-108	16	409	19	409
BCI60981.1	2.84e-107	6	411	10	415
QWT55360.1	7.77e-106	20	414	23	418
BBB93061.1	1.58e-96	14	409	15	407
ADG00238.1	1.94e-95	9	413	13	424

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	7.71e-07	36	276	120	379	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	7.96e-07	36	276	132	391	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	7.96e-07	36	276	133	392	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
6P61_A	3.21e-06	41	218	10	165	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	1.72e-17	40	301	45	306	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
P74165	5.77e-14	49	307	113	371	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q8YMK0	3.14e-13	49	305	111	370	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	7.44e-13	49	314	111	381	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q6UDF0	3.21e-09	29	283	76	338	Glucomannan 4-beta-mannosyltransferase 1 OS=Cyamopsis tetragonoloba OX=3832 GN=ManS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
9	31
299	321
333	355
370	389