CAZyme Information: MGYG000004194_01067

Basic Information

• Species: UBA737 sp002431945
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737; UBA737 sp002431945
• CAZyme ID: MGYG000004194_01067
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406		45631.81	5.7041

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004194	2120040	MAG	United Kingdom	Europe

• Gene Location: Start: 1701; End: 2921 Strand: -

Full Sequence      

MAKIKACVVGLGNRGYDIIRGVLLKNDDIEIISVCDVYEDRIARAAEKIKEAGSEPRGFT
DYKEALAVKGLNAVFIFSDWSSHTEIAVYAMKQGIPVASEVGCEYSVENCLRLVKTQEET
GTPYMFVENCCWGKEELLATSMARKKLFGTVVHCSGAYAHDLRNEIAYGHINRHYRFDNY
LNRCCDNYPTHELGPIAKLLDINRGNRILTVSSFASKSAGLEEYISTRGDATEEMKSARF
AQGDIITTVLTCAHGETVLLRLDTTLPRSYSRDFTVRGTKGMYMQDTNTVFLDGDEEFYE
PVKYYEKALNNAVQFENDYLPDIWKIITPEARRAGHGGMDWFAYKGFTDALINKTEMPID
VYDAAVWQAVSVLSEISVKQGGAPQAMPDFTNGKWFKRARRDVCSL

Enzyme Prediction     

No EC number prediction in MGYG000004194_01067.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	396	1.6e-124	0.9849624060150376

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.80e-13	1	309	1	286	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	2.28e-08	4	125	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH41319.1	2.35e-143	3	397	7	399
QUO31207.1	4.58e-139	1	398	1	398
QTH43530.1	1.35e-138	3	398	4	398
ALS29040.1	6.23e-138	3	398	4	398
QJD87109.1	1.60e-134	2	395	3	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	8.02e-87	3	395	20	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	2.48e-56	1	406	40	449	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3E18_A	3.36e-06	1	153	3	148	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	4.39e-86	3	395	20	431	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	8.23e-86	3	398	33	444	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8G1	4.84e-78	9	398	58	462	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	3.65e-73	3	398	49	460	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A6KY05	8.51e-67	9	398	22	413	Glycosyl hydrolase family 109 protein 2 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0611 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004194_01067.